KEGG   Bacillus subtilis subsp. subtilis 168: BSU38340
Entry
BSU38340          CDS       T00010                                 

Symbol
ywbF
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1_like MFS_1 Nuc_H_symport LacY_symp MFS_2
Other DBs
NCBI-GeneID: 937325
NCBI-ProteinID: NP_391713
Pasteur: BG10567
BSORF: BG10567
UniProt: P39589 A0A6M4JQG2
Position
3934358..3935557
AA seq 399 aa
MHNLQVRRHYAALKGFYLFAFLGTGSIIPLLSMYLTKEQHLSGSQVGLIMSLGPIVMIFF
QPFWGMLSDYTQKTKGLLAVCTSITGIIGLAYIAFDSFPLFILIAACFAAFQSTIIPLSD
SISLRYTQETNGNYGGIRLFGSLGFGVAVFAMGQVTNQLYPIHVIFIFGCAFLCIAAILA
SQVPGQQKTTKVNIRKGFRELISNKTFLIFMIITFTTFAPNLANNTYFSLFLDKSGASLS
AIGILFFIGVISEIPFMRFAQTFIDKMGLLNVIMLSGGVSLFRWALYFTAPSLWIIYATV
FLQGVAIGLFIPAALQYVKKITPRHVEATALTMYAAIGNGFGNWFCTFAGGYIFDYVSIF
AVYLLFGILSIAGFGLTLYLMKAEKNKHTLHQPAVTFKP
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgcacaacttgcaggtgaggcggcattatgccgcgttaaaaggattttatttgtttgct
tttctcggtacgggcagcataattcccttactcagtatgtatttaacgaaggaacagcat
ttaagcggatcacaggtcggcttgatcatgtcactgggcccgattgtgatgattttcttt
cagccgttttggggcatgctgagcgactatacgcaaaaaacgaaaggcctgctggcggtt
tgcacatcaatcacaggcatcattggattagcctatattgcatttgacagtttccctctg
tttattttgattgcggcctgttttgcagcctttcaaagcacgattattccactttcggac
agcatttcactaaggtacacacaagaaacaaacggcaactacggcggaatccgcctgttt
ggttctctcggcttcggtgtcgcggtgtttgccatgggacaggtgacgaaccagctgtac
cccattcacgtgatctttatctttggctgtgcctttctgtgcattgctgccatattggct
tcacaagtgcccggccagcagaaaacaacaaaggtcaatatccgcaaaggattccgggag
cttatcagcaacaaaactttcctcatctttatgatcatcacctttacgacatttgctcca
aacttagcgaacaatacgtatttcagtctttttctggacaaaagcggcgcgtcactttcc
gctatcggcattttatttttcatcggtgtcatttcagaaattccatttatgagattcgcc
caaacatttatagataaaatggggctgctcaacgtcattatgctgtcaggcggagtctca
ttattcaggtgggcgctctatttcacggcgccttcactatggatcatttatgcgacggtc
tttcttcagggagtggccatcggtttatttatcccggcggcgcttcaatatgtgaaaaag
attaccccaagacacgttgaagcgacggcgctgaccatgtacgccgccattggcaacggg
ttcggcaactggttctgcacatttgcaggcgggtacatttttgactacgtgtcgatcttc
gcagtctacttgctttttggcattctgagcatagcaggctttggcctgacattatattta
atgaaggctgaaaaaaacaaacatacacttcatcagccggctgttacttttaaaccataa

DBGET integrated database retrieval system