KEGG   Bacillus subtilis subsp. subtilis 168: BSU38350
Entry
BSU38350          CDS       T00010                                 

Gene name
ywbE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2196
Other DBs
NCBI-GeneID: 937326
NCBI-ProteinID: NP_391714
Pasteur: BG10566
BSORF: BG10566
UniProt: P39588 A0A6M4JQH5
Position
3935591..3935788
AA seq 65 aa
MNGQERNSISKGLQVDIVLKADQKTGKLTRGTVKDILTKSNFHPHGIKVRLEDGRIGRDQ
QIVST
NT seq 198 nt   +upstreamnt  +downstreamnt
atgaacgggcaagagcgaaacagcatttcgaaagggttgcaggttgatattgtattgaaa
gcagatcaaaaaacaggaaaactgacgagagggacagtgaaggatattttgacgaaatca
aactttcatccgcatggcattaaagtccgtcttgaagatggccgcatcggccgcgaccag
cagatcgtttctacataa

DBGET integrated database retrieval system