KEGG   Bacillus subtilis subsp. subtilis 168: BSU38360
Entry
BSU38360          CDS       T00010                                 

Gene name
ywbD
Definition
(RefSeq) ribosomal RNA large subunit methyltransferase YwbD
  KO
K06969  23S rRNA (cytosine1962-C5)-methyltransferase [EC:2.1.1.191]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU38360 (ywbD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.191  23S rRNA (cytosine1962-C5)-methyltransferase
     BSU38360 (ywbD)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSU38360 (ywbD)
SSDB
Motif
Pfam: Methyltrans_SAM PUA_3 Cons_hypoth95 Met_10 PUA tRNA_Me_trans MTS PrmA
Other DBs
NCBI-GeneID: 937328
NCBI-ProteinID: NP_391715
Pasteur: BG10565
BSORF: BG10565
UniProt: P39587 A0A6M3ZHK6
Position
complement(3935824..3937014)
AA seq 396 aa
MKLLTLKKAHAAKIKKGYPLIEKEALAGSAGHMKEGDLVDIVSESGGEFLARGYYGLQNK
GVGWTLTRNKHEQIDQAFFLSKLTKAAQARAKLFEAQDTTAFRLFNGEGDGVGGVTIDYY
DGYLLIQWYSKGIYTFKDMLISALDEMDLDYKAIYEKKRFDTAGQYVEDDDFVKGRRGEF
PIIIQENGIQYAVDLNEGAMTGIFLDQRHVRKAIRDRYAKGKTVLNTFSYTGAFSVAAAL
GGAEKTTSVDVANRSLAKTIEQFSVNKLDYEAHDIKVMDVFNYFSYAAKKDLRFDLIILD
PPSFARTKKRTFSAAKDYKNLLKETIAITADKGVIVASTNSSAFGMKKFKGFIDAAFKET
NERYTIIEEFTLPEDFKTISAFPEGNYLKVVLLQKK
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgaagctactcaccctaaaaaaagcacacgctgccaaaataaaaaaaggctatcccctt
attgaaaaagaagctctcgcagggagtgcggggcacatgaaagaaggagacctcgttgat
atcgtgtctgagagcggcggcgagtttctcgcgcggggctattacggcctgcaaaacaaa
ggggttggctggacgcttacccgcaataaacatgaacagattgaccaagcattttttctc
agcaaattaacaaaagcggcccaagcgcgcgccaaactatttgaggctcaagatacaaca
gctttccgcctgttcaacggtgagggtgacggtgtcggcggcgtcaccatcgactattat
gacggctacctgctgattcaatggtacagcaagggaatttacacctttaaagacatgctg
atttccgcattggatgagatggatcttgattataaagcgatttacgagaagaaacgcttc
gacacggctggacaatacgttgaagatgatgacttcgtgaaagggagaaggggcgagttc
ccgatcatcatccaagagaatggcattcaatacgcggtggatctgaatgaaggcgccatg
acgggcatctttttggatcagagacatgtgcgcaaggcgatcagagaccgctatgcaaaa
gggaaaaccgttttaaatacgttttcttatacgggtgcattctccgtggcggcggcgctt
ggcggagcggagaaaacaacaagcgtcgacgtggcaaatcgaagtcttgccaaaacgatc
gagcaattcagcgtgaacaagctggattacgaagcgcacgacattaaagtgatggacgtt
tttaactatttttcatatgctgcaaaaaaggatttgcgctttgatctgattattctagat
ccgccttcctttgcgcgcacaaaaaaacgcaccttcagcgcggccaaggattataaaaac
ctgctgaaggaaacgatcgccatcactgctgacaagggtgtcattgttgcctctacaaac
agcagcgcctttggcatgaagaagttcaaaggctttattgatgccgcctttaaagaaaca
aatgaacgctacacgatcattgaggaatttacgctgccggaggatttcaaaacgatttcg
gcatttccggaaggcaactacctgaaagtggtccttctgcagaaaaaataa

DBGET integrated database retrieval system