KEGG   Bacillus subtilis subsp. subtilis 168: BSU38370
Entry
BSU38370          CDS       T00010                                 

Gene name
ywbC
Definition
(RefSeq) hypothetical protein
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU38370 (ywbC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     BSU38370 (ywbC)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3 Glyoxalase_2 Glyoxalase_6 Y_Y_Y
Other DBs
NCBI-GeneID: 937329
NCBI-ProteinID: NP_391716
Pasteur: BG10564
BSORF: BG10564
UniProt: P39586 A0A6M3ZK88
Position
3937135..3937515
AA seq 126 aa
MAKRIDHTGIMVRDINASITFYEEVLGMKLKDRITHTNGVIELAFLGFEDGPETEIELIQ
GYSSELPAEGKVHHIALLTDDIAAEYTKAEKMNAKFIDEEITTLPNGYRYFYIEGPDGEW
IEFFQR
NT seq 381 nt   +upstreamnt  +downstreamnt
atggcaaaacgaattgaccatacaggcatcatggtaagagatattaacgcgtccatcaca
ttttatgaagaggtactaggcatgaaattgaaggatcgcatcactcacacgaacggtgta
atcgagcttgcttttcttggctttgaagacggcccggaaacagaaattgaactgattcaa
ggctacagcagcgagcttcccgctgaaggaaaagtgcaccacattgccctgctgacggat
gacatcgcggctgaatatacaaaagcggaaaaaatgaacgcaaaatttatcgacgaggag
atcacaacacttccaaacggataccgttatttctatatcgaaggccctgacggtgagtgg
attgagttctttcagcggtaa

DBGET integrated database retrieval system