KEGG   Bacillus subtilis subsp. subtilis 168: BSU38380
Entry
BSU38380          CDS       T00010                                 

Symbol
ywbB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2711
Other DBs
NCBI-GeneID: 937330
NCBI-ProteinID: NP_391717
Pasteur: BG10563
BSORF: BG10563
UniProt: P39585 A0A6M3ZI00
Position
complement(3937553..3938230)
AA seq 225 aa
MLDYIWLDDESPILQQVPVEYSSAALIFSPFIQMPEGWENAKRKNDYEHIYPNDNEIRGI
GKAVSWKKVMSSCGFQTHAELALALMTSIGALRDEFAREDLAEVLHENINGDLYYPSEDH
ISNFHIPSLVKVLGANGSNRFYYAEPIVENRGVLDITEANLRTVLDEAATELVLTDEKMD
FVFMSVYDSFINVFLAKDKNIHELVERMGWEAMICDESTYISWYR
NT seq 678 nt   +upstreamnt  +downstreamnt
atgctagattatatatggttagatgacgaatcaccaatcttacaacaagtaccagttgaa
tactcatctgctgctcttatcttttctccttttatccaaatgcctgaaggatgggagaat
gcaaaaagaaaaaatgattatgaacatatttatccaaacgataatgaaataagaggaata
ggcaaggctgtttcctggaagaaggttatgtcttcttgcggctttcaaacacatgctgag
ctggcgctggctttaatgacgtcgataggcgctttaagggacgagttcgcgagagaggat
ttggctgaggtgttacatgaaaacataaatggagacctctattatcccagtgaggatcat
atttcaaattttcatattccgagtttggtaaaggtattaggtgcgaacggatccaatcgg
ttttattacgcagaaccgattgtggaaaaccgcggcgttttggacataactgaagccaac
ttgcggacggttcttgatgaagccgcaacagagctcgttttaactgatgagaaaatggat
tttgtgtttatgagtgtatatgactcattcattaatgtctttttagccaaagataaaaac
atccatgaattggttgagcgtatgggctgggaagctatgatttgcgatgagtcaacgtat
atcagttggtatagataa

DBGET integrated database retrieval system