KEGG   Bacillus subtilis subsp. subtilis 168: BSU38390
Entry
BSU38390          CDS       T00010                                 

Gene name
ywbA
Definition
(RefSeq) permease IIC component YwbA
  KO
K02761  cellobiose PTS system EIIC component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU38390 (ywbA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU38390 (ywbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38390 (ywbA)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU38390 (ywbA)
SSDB
Motif
Pfam: PTS_EIIC
Other DBs
NCBI-GeneID: 937331
NCBI-ProteinID: NP_391718
Pasteur: BG10562
BSORF: BG10562
UniProt: P39584 A0A6M3ZLM0
Position
complement(3938307..3939641)
AA seq 444 aa
MSTFTRVMEEKIMPVAGKIAGQRHLSALRDGIILTMPLIIIGSVFLILTSLPIPGYADFM
ASVFGNEWADKLGYPVNASFDIMAMIAAFGIAYRLAESYGVDALSAGAISIAAFLLATPF
EVPFTPHGSTESIMVGGGIPITLLGSKGLFVAMLIALFSTEIYRYIIQKNIVFKMPDGVP
PAVSKSFVALIPGFIIVLLVWLARLLIEMTPFQSLHNVVGDLLGTPLSILGGSLGGSLIA
EFVQMLLWSCGIHGASIIGGIMAPIWYGAMDANRLAFQAGEALPSIFTTQFFQIWINVGG
SGATLALVLTMLVRSRSKQMKQLGRLGIGPALFNINEPIIFGMPIVMNPLLIVPFIIAPL
LTITATYIGMSTGLVARPAGIAVPWTMPPLISGYLATGGKVSGAVMQLVNLLITCAIYYP
FFRIWDHQKWREESAVESGDKNVM
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgagcacattcactcgggtgatggaggaaaaaataatgcctgtcgccgggaaaattgcc
gggcagcggcatctcagcgctttgcgtgacggaattatcctgaccatgccgctgattatt
atcgggtctgtcttcttgattttaacgagcttgccgattccggggtatgctgatttcatg
gcgagtgtgtttgggaacgagtgggccgataagctcggatatcctgttaacgcttcgttt
gatattatggcgatgattgccgcttttgggatcgcctatcggctggcagaaagctatggt
gtcgatgccctttctgccggagcgatttcaattgccgcatttctgctggcaacaccgttt
gaggtgccgtttacaccgcatggctcaacggagtccatcatggtagggggcggaatcccg
atcacgctgctcggcagcaagggcttatttgtcgccatgctgatcgccttgttttcaacc
gaaatctatcggtacattattcaaaaaaatatcgtcttcaaaatgccagacggtgtgccg
cctgcggtaagcaaatcatttgtcgcgctgattcccggctttatcattgtgcttctcgta
tggctggcgcgtcttctgattgaaatgacaccttttcagagtctgcacaatgtcgtagga
gacctgcttggcacaccgctttccatccttggcggcagtctcggcggaagcctgatcgct
gaatttgtgcagatgctgctttggtcgtgcgggattcacggggcttccatcattggcgga
atcatggcgccgatttggtacggcgcgatggatgccaaccgtctcgccttccaagcaggc
gaggcgctgccgagtatttttacgactcagttttttcaaatttggatcaatgtcggcgga
agcggggcgacgctggcgcttgtcctgacgatgcttgtgcgctcccgcagcaaacaaatg
aagcagcttggacgattaggaatcggccctgcgctatttaatatcaacgagccgatcatt
ttcggcatgccgattgtcatgaatcccctccttattgtcccatttatcatcgcaccgctc
ctcacgattaccgcgacttatatcggcatgagcaccgggctggtggcaagaccggccgga
atcgcggtgccatggacgatgccgccgctcatatcaggttacctggcgacaggcggaaag
gtgtcgggcgcagttatgcagctggtaaatctgctgatcacctgtgctatctactatccg
tttttcagaatatgggatcatcaaaaatggcgggaagagagtgcggttgaatctggggat
aaaaatgtgatgtga

DBGET integrated database retrieval system