KEGG   Bacillus subtilis subsp. subtilis 168: BSU38400
Entry
BSU38400          CDS       T00010                                 

Symbol
epr
Name
(RefSeq) minor extracellular protease epr
  KO
K13277  minor extracellular protease Epr [EC:3.4.21.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU38400 (epr)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU38400 (epr)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BSU38400 (epr)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S8: subtilisin family
   BSU38400 (epr)
Chaperones and folding catalysts [BR:bsu03110]
 Intramolecular chaperones
  Subtilisin family
   BSU38400 (epr)
SSDB
Motif
Pfam: Peptidase_S8 Endotoxin_C2 Inhibitor_I9 efb-c FUSC
Other DBs
NCBI-GeneID: 937332
NCBI-ProteinID: NP_391719
Pasteur: BG10561
BSORF: BG10561
UniProt: P16396 A0A6M3ZIF9
Position
3939869..3941806
AA seq 645 aa
MKNMSCKLVVSVTLFFSFLTIGPLAHAQNSSEKEVIVVYKNKAGKETILDSDADVEQQYK
HLPAVAVTADQETVKELKQDPDILYVENNVSFTAADSTDFKVLSDGTDTSDNFEQWNLEP
IQVKQAWKAGLTGKNIKIAVIDSGISPHDDLSIAGGYSAVSYTSSYKDDNGHGTHVAGII
GAKHNGYGIDGIAPEAQIYAVKALDQNGSGDLQSLLQGIDWSIANRMDIVNMSLGTTSDS
KILHDAVNKAYEQGVLLVAASGNDGNGKPVNYPAAYSSVVAVSATNEKNQLASFSTTGDE
VEFSAPGTNITSTYLNQYYATGSGTSQATPHAAAMFALLKQRDPAETNVQLREEMRKNIV
DLGTAGRDQQFGYGLIQYKAQATDSAYAAAEQAVKKAEQTKAQIDINKARELISQLPNSD
AKTALHKRLDKVQSYRNVKDAKDKVAKAEKYKTQQTVDTAQTAINKLPNGTDKKNLQKRL
DQVKRYIASKQAKDKVAKAEKSKKKTDVDSAQSAIGKLPASSEKTSLQKRLNKVKSTNLK
TAQQSVSAAEKKSTDANAAKAQSAVNQLQAGKDKTALQKRLDKVKKKVAAAEAKKVETAK
AKVKKAEKDKTKKSKTSAQSAVNQLKASNEKTKLQKRLNAVKPKK
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgaaaaacatgtcttgcaaacttgttgtatcagtcactctgtttttcagttttctcacc
ataggccctctcgctcatgcgcaaaacagcagcgagaaagaggttattgtggtttataaa
aacaaggccggaaaggaaaccatcctggacagtgatgctgatgttgaacagcagtataag
catcttcccgcggtagcggtcacagcagaccaggagacagtaaaagaattaaagcaggat
cctgatattttgtatgtagaaaacaacgtatcatttaccgcagcagacagcacggatttc
aaagtgctgtcagacggcactgacacctctgacaactttgagcaatggaaccttgagccc
attcaggtgaaacaggcttggaaggcaggactgacaggaaaaaatatcaaaattgccgtc
attgacagcgggatctccccccacgatgacctgtcgattgccggcgggtattcagctgtc
agttatacctcttcttacaaagatgataacggccacggaacacatgtcgcagggattatc
ggagccaagcataacggctacggaattgacggcatcgcaccggaagcacaaatatacgcg
gttaaagcgcttgatcagaacggctcgggggatcttcaaagtcttctccaaggaattgac
tggtcgatcgcaaacaggatggacatcgtcaatatgagccttggcacgacgtcagacagc
aaaatccttcatgacgccgtgaacaaagcatatgaacaaggtgttctgcttgttgccgca
agcggtaacgacggaaacggcaagccagtgaattatccggcggcatacagcagtgtcgtt
gcggtttcagcaacaaacgaaaagaatcagcttgcctccttttcaacaactggagatgaa
gttgaattttcagcaccggggacaaacatcacaagcacttacttaaaccagtattatgca
acgggaagcggaacatcccaagcgacaccgcacgccgctgccatgtttgccttgttaaaa
cagcgtgatcctgccgagacaaacgtccagcttcgcgaggaaatgcggaaaaacatcgtt
gatcttggtaccgcaggccgcgatcagcaatttggctacggcttaatccagtataaagca
caggcaacagattcagcgtacgcggcagcagagcaagcggtgaaaaaagcggaacaaaca
aaagcacaaatcgatatcaacaaagcgcgagaactcatcagccagctgccgaactccgac
gccaaaactgccctgcacaaaagactggataaagtacagtcatacagaaatgtaaaagat
gcgaaagacaaagtcgcaaaggcagaaaaatataaaacacagcaaaccgttgacacagca
caaactgccatcaacaagctgccaaacggaacagacaaaaagaaccttcaaaaacgctta
gaccaagtaaaacgatacatcgcgtcaaagcaagcgaaagacaaagttgcgaaagcggaa
aaaagcaaaaagaaaacagatgtggacagcgcacaatcagcaattggcaagctgcctgca
agttcagaaaaaacgtccctgcagaaacgccttaacaaagtgaagagcaccaatttgaag
acggcacagcaatccgtatctgcggctgaaaagaaatcaactgatgcaaatgcggcaaaa
gcacaatcagccgtcaatcagcttcaagcaggcaaggacaaaacggcattgcaaaaacgg
ttagacaaagtgaagaaaaaggtggcggcggctgaagcaaaaaaagtggaaactgcaaag
gcaaaagtgaagaaagcggaaaaagacaaaacaaagaaatcaaagacatccgctcagtct
gcagtgaatcaattaaaagcatccaatgaaaaaacaaagctgcaaaaacggctgaacgcc
gtcaaaccgaaaaagtaa

DBGET integrated database retrieval system