KEGG   Bacillus subtilis subsp. subtilis 168: BSU38410
Entry
BSU38410          CDS       T00010                                 

Gene name
sacX
Definition
(RefSeq) negative regulator of SacY activity
  KO
K02810  sucrose PTS system EIIBCA or EIIBC component [EC:2.7.1.211]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU38410 (sacX)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU38410 (sacX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38410 (sacX)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.211  protein-Npi-phosphohistidine---sucrose phosphotransferase
     BSU38410 (sacX)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sucrose-specific II component
    BSU38410 (sacX)
SSDB
Motif
Pfam: PTS_EIIC PTS_EIIB
Other DBs
NCBI-GeneID: 937333
NCBI-ProteinID: NP_391720
Pasteur: BG10560
BSORF: BG10560
UniProt: P15400 A0A6M4JQH1
Position
3942234..3943613
AA seq 459 aa
MHKEIAKELLLLAGGKNNIISISHCTTRLRFDVKDETKIDIHAIENLQGVQGTFFRYGLF
QIIFGAGVVNKIYKEVVHVWETAPSEEPVHQKKASRKLNPAAAFAKTLSDIFVPIIPAIT
ASGLLMGLIGMIKVFHWFAAGSPWIKMLDLVSSTAFILLPILVGFSAARQFGSNPYLGAV
IAGLLTHPDLLDPSMLGSKTPSSLDIWGLHIPMMGYQGSMIPILLSVFVMSKIEKLLKSI
VPKSLDVVIIPFITVMVTGCLALIVMNPAASIIGQIMTQSIVYIYDHAGIAAGALFGGIY
STIVLSGLHHSFYAIEATLLANPHVGVNFLVPIWSMANVAQGGAGLAVFLKTKQSSLKKI
ALPASLTAFLGIVEPIVFGVNLKLIRPFIGAAIGGAIGGAYVVAVQVVANSYGLTGIPMI
SIVLPFGAANFVHYMIGFLIAAVSAFIATLFLGFKEETE
NT seq 1380 nt   +upstreamnt  +downstreamnt
ttgcataaagagattgcaaaagaattactgctgctcgcaggaggaaaaaacaatattatc
agcatcagccattgtacgacccgtcttcgttttgatgtaaaggacgagacgaaaattgat
atacatgccattgagaacctgcaaggtgtgcagggcacctttttccgctatgggcttttc
cagattatcttcggagcaggcgtcgtcaacaaaatatataaagaagtcgttcatgtatgg
gagaccgcgccttctgaagagcctgtccaccagaaaaaagccagccggaagctgaaccct
gccgcagcttttgcgaaaacactgtccgatatttttgtgccgattattccggcaataaca
gcaagcggcctgctcatggggctgatcggcatgattaaggtgtttcattggttcgctgcc
ggcagcccatggattaaaatgctcgacctcgtgtccagcacagcctttattttactgccg
attttagtcggcttcagtgctgcacggcaatttggcagcaacccatacctaggggcagtg
attgcagggcttttgacgcatcctgatctgctggacccgtctatgctcggcagcaaaacc
ccgtcttctttagacatatgggggcttcatatcccaatgatgggctatcagggttccatg
ataccgattcttctttccgtttttgtcatgagcaaaattgagaagctattaaaatcgatt
gtgccgaagtcgcttgatgtcgtgatcattccctttattacggtcatggtgacagggtgc
ctcgcgctgattgtgatgaatcccgccgcgtccatcatcggccagatcatgacacaatcg
atcgtctatatttatgatcacgccggcattgctgccggagctcttttcggcggcatctac
tccaccatcgtcctatctggattgcatcatagcttttatgcaattgaggcaacgctgctt
gctaatccgcatgtcggtgtcaactttttagtgccgatatggtcgatggcgaatgtggcc
caaggcggagcggggcttgcggtattcctcaaaacgaaacaatcaagcctgaagaaaatt
gcgctccccgcttctctgaccgcgtttttaggcattgttgagccgattgtattcggggta
aatctcaaattgatccgtccctttatcggagcagccatcggcggtgctattggcggagca
tacgtggttgcggtacaagttgtggcaaattcctacggactgacaggcattccgatgatt
tcaatcgtgctgccgtttggcgccgctaattttgttcattatatgatcggtttcttgatc
gcagccgtctctgcttttatagctacattgtttctcgggtttaaagaagagacagaataa

DBGET integrated database retrieval system