KEGG   Bacillus subtilis subsp. subtilis 168: BSU38420
Entry
BSU38420          CDS       T00010                                 

Gene name
sacY
Definition
(RefSeq) levansucrase and sucrase synthesis operon antiterminator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PRD CAT_RBD VIGSSK
Other DBs
NCBI-GeneID: 937335
NCBI-ProteinID: NP_391721
Pasteur: BG10559
BSORF: BG10559
UniProt: P15401 A0A6M4JQG3
Structure
PDB: 
1AUU

Position
3943667..3944509
AA seq 280 aa
MKIKRILNHNAIVVKDQNEEKILLGAGIAFNKKKNDIVDPSKIEKTFIRKDTPDYKQFEE
ILETLPEDHIQISEQIISHAEKELNIKINERIHVAFSDHLSFAIERLSNGMVIKNPLLNE
IKVLYPKEFQIGLWARALIKDKLGIHIPDDEIGNIAMHIHTARNNAGDMTQTLDITTMIR
DIIEIIEIQLSINIVEDTISYERLVTHLRFAIQHIKAGESIYELDAEMIDIIKEKFKDAF
LCALSIGTFVKKEYGFEFPEKELCYIAMHIQRFYQRSVAR
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaaaattaaaagaatcttaaatcataatgctatcgtcgtaaaggatcaaaatgaagag
aagattctcttgggtgcaggaattgcgtttaacaaaaagaagaatgatattgtcgatccg
tcaaaaatagaaaaaacctttatcagaaaagatacacctgactataagcagttcgaagag
attttagaaacattgcctgaagaccacattcagatttctgagcaaattatctctcatgcc
gaaaaagagctgaacatcaaaatcaacgagcgcattcatgtcgctttttcagaccatctt
tcttttgcaattgaacgcctgagcaatgggatggttatcaaaaatccgctgctgaatgaa
atcaaagtcctttatccaaaggagttccagatcggcttatgggccagagcactgattaaa
gataaactggggattcacattcctgatgatgaaatcggcaatatcgccatgcatatccac
acagcaagaaacaatgccggcgatatgacacaaacgcttgatattacaacaatgatccgt
gatattatcgagattatcgaaattcaactgtctattaatatcgttgaagataccatctct
tatgaaaggctcgtgacccatctccgctttgccattcagcatatcaaagcaggcgaatcc
atttacgagctggacgcagaaatgattgacatcattaaagagaagtttaaggatgccttc
ctgtgtgccctaagcatcggcacctttgtgaagaaggaatacggctttgagtttcctgaa
aaagaattgtgctacatcgccatgcatattcagcggttctaccaacggtcagtcgcacgc
tga

DBGET integrated database retrieval system