KEGG   Bacillus subtilis subsp. subtilis 168: BSU38430
Entry
BSU38430          CDS       T00010                                 

Gene name
gspA
Definition
(RefSeq) general stress protein A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-GeneID: 937339
NCBI-ProteinID: NP_391722
Pasteur: BG10558
BSORF: BG10558
UniProt: P25148 A0A6M3ZHU2
Position
complement(3944560..3945420)
AA seq 286 aa
MRKDEIMHIVSCADDNYARHLGGMFVSLLTNMDQEREVKLYVIDGGIKPDNKKRLEETTL
KFGVPIEFLEVDTNMYEHAVESSHITKAAYYRISIPDLIKDESIKRMIYIDCDALVLEDI
SKLWDLDIAPYTVAAVEDAGQHERLKEMNVTDTGKYFNSGIMIIDFESWRKQNITEKVIN
FINEHPDEDFLVLHDQDALNAILYDQWYELHPRWNAQTYIMLKLKTPSTLLGRKQYNETR
ENPAIVHFCGGEKPWNSNTKHPYRDEYFHYMSYTKWNTIGNPAINQ
NT seq 861 nt   +upstreamnt  +downstreamnt
ttgaggaaagatgaaatcatgcatatcgtatcatgcgcagatgataattatgctcgtcat
ttaggtgggatgttcgtttctttattgactaacatggatcaggagagagaggtaaaatta
tacgtcattgatggcggaattaagcctgataacaaaaaaagactggaagaaaccactttg
aaattcggagtgccgattgagtttttagaagtggataccaacatgtatgaacatgcggtt
gagagcagccatattacaaaagccgcgtattaccgcatttcgattcccgacttaattaag
gatgaaagcatcaaacgaatgatttacatcgattgtgatgcgcttgtcctagaggatatt
tctaagctatgggacttagacattgcgccatacaccgtagccgctgttgaggatgcgggg
cagcatgaacgcctgaaagaaatgaacgtcactgatacagggaagtattttaactcaggt
atcatgattattgattttgagtcttggagaaagcaaaacatcacagaaaaagtcatcaac
tttatcaatgaacacccagacgaagactttcttgtgctgcatgaccaagatgcactgaat
gcgatcttgtatgatcagtggtatgaacttcatccgcgctggaacgctcaaacctatatc
atgttaaagctgaaaaccccatcgactctgttagggcggaagcaatataatgaaacaaga
gaaaacccggcaatcgtgcacttctgcggcggagaaaagccttggaactccaatacaaaa
catccgtatcgcgatgagtatttccattacatgtcctatacgaagtggaatacgattggg
aatccggcgatcaaccaataa

DBGET integrated database retrieval system