KEGG   Bacillus subtilis subsp. subtilis 168: BSU38440
Entry
BSU38440          CDS       T00010                                 

Gene name
ywaF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Intg_mem_TP0381
Other DBs
NCBI-GeneID: 937341
NCBI-ProteinID: NP_391723
Pasteur: BG10557
BSORF: BG10557
UniProt: P25149 A0A6M3ZHG5
Position
complement(3945530..3946243)
AA seq 237 aa
MQKYVQSDYKHDPFHLFSTEHVVTLAIISLLAILLFLFQDEVKQPRASRFLRSLFVFLLL
GSQIGYQIWMVATDRWSVRTSLPLQLSDLSVYLSAIMLVTKSRKLFVFLFFVGIGSSIQA
LATPDLGMFSFPHIRYILFFISHGSVFLSCLLMAVIGTYRMGQRSLWVTVLLVNVYGVCI
FLIDRWLGANYMYLTKKPGGSSLLDVLGPWPWYIVSAEAITIASFFILYWLYRIFKK
NT seq 714 nt   +upstreamnt  +downstreamnt
ttgcaaaaatatgttcaatccgactataagcatgatccgtttcatctgttttcgacagag
catgtagtgacgttagcgattatctcccttttggccattctgttgtttttgttccaagat
gaggtcaagcagccgagggccagccggtttttgcgttctctgtttgtgtttcttttgctt
ggttcgcaaatcggctatcaaatatggatggtcgccacggacaggtggtcggtgcgcact
tcattgcctctccagcttagtgacctgtcggtgtatttgtcagctattatgttagtgaca
aaaagcagaaagctgtttgtgtttttgttttttgtcggcatcggcagttcgattcaggct
cttgccactcctgacctcggtatgttttcatttccgcatatccgatatatcctctttttt
atttctcacgggtctgtgtttttatcctgtctgctgatggctgtgattggcacctacaga
atgggccagcgctcgttatgggtgacagtcctgcttgttaatgtgtacggcgtctgtatt
tttctgattgatcgctggcttggcgcgaattatatgtatttgacgaaaaaaccgggcggt
tcctctctcttagatgttctcgggccatggccgtggtatatcgtctcggctgaagccatc
acaatcgcaagctttttcattctttattggctttatcgcatcttcaaaaaatga

DBGET integrated database retrieval system