KEGG   Bacillus subtilis subsp. subtilis 168: BSU38450
Entry
BSU38450          CDS       T00010                                 

Symbol
ywaE
Name
(RefSeq) HTH-type transcriptional regulator YwaE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR HTH_27 TrmB HTH_34 LacI RepL HTH_36 MarR_2 HTH_24
Other DBs
NCBI-GeneID: 937344
NCBI-ProteinID: NP_391724
Pasteur: BG10556
BSORF: BG10556
UniProt: P25150 A0A6M4JQI4
Position
3946394..3946909
AA seq 171 aa
MERSHQHQQLRKEEHDTLSKLKQMPVESLNLEAISIATNLYRSAQRLRVKMETEVLSTYN
LSWTAFSILYDLWVWGALETRKIAELSGISTATASNVIKTLEKKSFCRKSIDTRDRRLVF
VSITDSGKQAIEELYPEFHKGETELIAGMTKDEQKILTGLLRKVADNLHTT
NT seq 516 nt   +upstreamnt  +downstreamnt
atggaacgttcacatcaacatcagcagcttcggaaggaagaacacgatacactttctaag
ctcaaacaaatgcccgtcgagtcactcaacctggaagccatttcgatcgctacgaatctg
tatcggtctgcacaaaggctccgtgtcaaaatggagactgaggttctttctacctataac
ctttcttggaccgctttctccattctttatgatctatgggtatggggagcgctcgaaacg
agaaaaatcgctgagctgtcagggatatctacagctacagcaagcaacgtgatcaaaacg
ctcgaaaaaaagagtttttgccgtaaaagcatcgacacaagagatcggcgactcgtgttt
gtctcaatcaccgattccggcaaacaagcgatcgaagaactctacccggagtttcacaaa
ggggaaacagagctcattgcgggaatgacgaaggacgaacagaaaatattgacagggctg
cttagaaaggtagctgacaatcttcatacaacataa

DBGET integrated database retrieval system