KEGG   Bacillus subtilis subsp. subtilis 168: BSU38460
Entry
BSU38460          CDS       T00010                                 

Gene name
tyrZ
Definition
(RefSeq) tyrosine--tRNA ligase 2
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU38460 (tyrZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU38460 (tyrZ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU38460 (tyrZ)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU38460 (tyrZ)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     BSU38460 (tyrZ)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BSU38460 (tyrZ)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU38460 (tyrZ)
 Prokaryotic type
    BSU38460 (tyrZ)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSU38460 (tyrZ)
SSDB
Motif
Pfam: tRNA-synt_1b S4 S4_2 TyrRSs_C Unstab_antitox
Other DBs
NCBI-GeneID: 937345
NCBI-ProteinID: NP_391725
Pasteur: BG10555
BSORF: BG10555
UniProt: P25151 A0A6M4JQJ9
Position
3947158..3948399
AA seq 413 aa
MMRTFEQLTASQQKEVERQLQLYMTGAHEVIPPEELKAKLVKSISTGTPLKIKLGLDPSA
PDVHLGHTVVLNKLRQFQENGHIVQLLIGDFTGKIGDPTGKSAARKQLTDEEVQHNAKTY
FEQFGKVLDPEKVELHYNSKWLKTLNLEDVIELAGKITVARLMERDDFEERIAMQKPISL
HEFFYPLMQGYDSVVLESDIELGGTDQHFNVLMGRHFQERYNKEKQVVILMPLLEGLDGV
EKMSKSKHNYIGINEHPNDMYGKTMSLPDSLMKKYIHLATDLELEEKKQLVKDLETGAVH
PRDAKMLLARTIVRMYHGEKAAEAAEHSFKTVFQENSLPEDIPAVNWKGEKTIAMIDLLV
KLKLLSSKSEARRMIQNGGVRIDGEKVTDVHAKAEIRENMIIQVGKRKFLKLQ
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgatgagaacatttgagcagctcacagcgtcacaacaaaaagaggtagaaagacagctt
cagctatacatgacaggcgcccacgaagtcataccgccggaggaattaaaggcaaagctc
gtgaaatcaatttccacgggcacgccgcttaaaattaagctcggattagatccgtctgca
ccggatgtacatttgggccatacggttgtgttaaataagcttcgccaatttcaagaaaac
ggccacattgtccagctgttaattggggatttcacaggaaaaattggtgatccgaccgga
aaatcggcagccagaaagcaactgactgatgaagaagttcagcacaatgccaaaacctac
tttgagcaattcggaaaagtgcttgatccagaaaaagtcgagcttcactataactcaaaa
tggctgaaaacattgaatctagaagatgtcattgaattagcagggaaaataacggtagcc
cgcctgatggagcgcgacgactttgaagaacgcatcgccatgcaaaaaccaatctcactg
catgaattcttttacccattgatgcagggctatgattctgtcgttctcgaaagtgatatt
gaattaggcggaacggatcagcatttcaatgtcctcatgggacggcatttccaagaacga
tacaacaaagaaaaacaagtcgtcatccttatgccgctcttggaaggcttggatggcgtc
gagaaaatgtcgaagtcgaaacacaactacattggcattaacgaacatccaaacgacatg
tacggaaaaacgatgtcactgcccgacagcctgatgaaaaagtacatccacttggcgaca
gacttagagcttgaagagaaaaaacagctcgtaaaagacttagaaaccggcgccgttcat
ccgcgtgatgccaaaatgcttttagccagaacaatcgtccgaatgtatcacggagagaaa
gcagcagaagctgccgaacactcgtttaaaacagtctttcaggaaaacagcctgccggaa
gatataccggccgtaaactggaaaggcgaaaaaacgatagcgatgattgatctgctcgtc
aagctaaagctcctctcttcgaagagcgaggcgcgccgcatgattcaaaacggaggtgta
cgcatcgacggagagaaagtaacagatgttcacgccaaagcagagataagagagaatatg
atcatccaagtcggcaaacgcaagtttttaaagctccaataa

DBGET integrated database retrieval system