KEGG   Bacillus subtilis subsp. subtilis 168: BSU38470
Entry
BSU38470          CDS       T00010                                 

Symbol
ywaD
Name
(RefSeq) aminopeptidase YwaD
  KO
K19701  aminopeptidase YwaD [EC:3.4.11.6 3.4.11.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU38470 (ywaD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     BSU38470 (ywaD)
    3.4.11.10  bacterial leucyl aminopeptidase
     BSU38470 (ywaD)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   BSU38470 (ywaD)
SSDB
Motif
Pfam: Peptidase_M28 PA Peptidase_M20 DUF4910 Nicastrin
Other DBs
NCBI-GeneID: 937350
NCBI-ProteinID: NP_391726
Pasteur: BG10554
BSORF: BG10554
UniProt: P25152 A0A6M3ZIW2
Structure
PDB: 
6HC6 6HC7

Position
3948555..3949922
AA seq 455 aa
MKKLLTVMTMAVLTAGTLLLPAQSVTPAAHAVQISNSERELPFKAKHAYSTISQLSEAIG
PRIAGTAAEKKSALLIASSMRKLKLDVKVQRFNIPDRLEGTLSSAGRDILLQAASGSAPT
EEQGLTAPLYNAGLGYQKDFTADAKGKIALISRGDLTYYEKAKNAEAAGAKAVIIYNNKE
SLVPMTPNLSGNKVGIPVVGIKKEDGEALTQQKEATLKLKAFTNQTSQNIIGIKKPKNIK
HPDIVYVTAHYDSVPFSPGANDNGSGTSVMLEMARVLKSVPSDKEIRFIAFGAEELGLLG
SSHYVDHLSEKELKRSEVNFNLDMVGTSWEKASELYVNTLDGQSNYVWESSRTAAEKIGF
DSLSLTQGGSSDHVPFHEAGIDSANFIWGDPETEEVEPWYHTPEDSIEHISKERLQQAGD
LVTAAVYEAVKKEKKPKTIKKQMKAKASDIFEDIK
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaaaaagcttttgactgtcatgacgatggctgttttaactgccggcacactgctcttg
ccggcacagagtgtcacccctgccgcgcacgctgtacaaatatcaaatagcgagcgcgag
cttccattcaaagcaaaacatgcgtactctaccatttctcagctaagtgaagcaatcggc
cccagaatagccggaactgcagctgaaaaaaagagtgccctattgatcgcctcatcaatg
agaaaattaaagcttgatgtgaaggttcaacgattcaacattcctgaccggcttgagggt
acactgtcttcagcaggacgcgatattcttctccaagcggcgtcgggctcagctccgact
gaggaacaagggctgacggccccgctttacaatgcgggattgggctatcaaaaggacttt
accgctgacgccaagggcaaaatcgccttgatttccagaggagacctgacttattacgag
aaagccaaaaatgccgaagccgccggagcgaaagctgtcatcatttataacaacaaagaa
agcctcgtgcctatgacgccaaacctgtcgggaaataaagtcggcattccggtcgtcggc
attaagaaagaagacggcgaagcacttacccagcaaaaagaagccaccttaaaactaaaa
gcattcacaaaccaaacctcccagaatatcatcggaatcaaaaaaccaaagaacatcaaa
catccagacattgtgtacgtgaccgcccattacgacagtgttcctttttcgcccggagca
aatgacaacggctcaggtacctctgttatgctggagatggcgcgtgtcttaaaaagcgtt
ccatctgataaagaaatccgctttatcgctttcggcgccgaagagctcggcctgctcggc
tcctctcactatgtagatcatctatcggaaaaagagctgaaacgaagcgaagtgaacttc
aacttagatatggtaggcacaagctgggaaaaagcgtctgagctgtatgtcaacacattg
gatggccaatctaactatgtttgggaatccagccgtacggctgctgaaaaaattgggttt
gacagcctgtctctgacacagggaggatcatctgatcatgtgccattccacgaagccggc
attgattccgctaactttatttggggagacccggaaacagaagaagttgagccgtggtat
catacccctgaagactcgatcgaacatatcagcaaagaacgcctccagcaagcaggcgat
cttgtgacagccgctgtctatgaggctgtgaaaaaagagaagaaaccgaaaaccattaag
aaacaaatgaaggcgaaagcatctgacatttttgaagatatcaaataa

DBGET integrated database retrieval system