KEGG   Bacillus subtilis subsp. subtilis 168: BSU38480
Entry
BSU38480          CDS       T00010                                 

Gene name
ywaC
Definition
(RefSeq) GTP pyrophosphokinase YwaC
  KO
K07816  putative GTP pyrophosphokinase [EC:2.7.6.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU38480 (ywaC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     BSU38480 (ywaC)
SSDB
Motif
Pfam: RelA_SpoT
Other DBs
NCBI-GeneID: 937355
NCBI-ProteinID: NP_391727
Pasteur: BG10553
BSORF: BG10553
UniProt: P39583 A0A6M4JQI8
Structure
PDB: 
6FGK

Position
complement(3949952..3950584)
AA seq 210 aa
MDLSVTHMDDLKTVMEDWKNELLVYKFALDALDTKFSIISQEYNLIHGHNPIEHTKSRVK
SFESIVNKLMRKGCEITTKEMKEHIHDIAGVRIICSFISDIYNVVNVLKQHEDLRIVKVK
DYIQTPKPNGYRSLHLIIEMPVNLTNRVEYVKAEIQIRTIAMDFWASLEHKIYYKLNNDV
PKQLTDELKEAAEIAHYLDEKMLGIKKEVD
NT seq 633 nt   +upstreamnt  +downstreamnt
atggatttatctgtaacacatatggacgatttaaaaacagtaatggaagattggaaaaat
gagttattagtttataaatttgcgctagatgcgctcgatacaaagttctcaattatcagc
caggaatataacctcattcacggacacaacccgattgaacatacaaaatcccgtgtaaaa
agctttgaaagcatcgtgaataagttaatgagaaagggctgtgagattacgacgaaggaa
atgaaggagcatattcacgacattgccggcgtgcgcatcatctgttcctttatttctgac
atttataatgtcgtgaatgtgttgaagcagcatgaagatttgagaatcgtaaaggtaaag
gattatatccagacacccaaaccgaatggctatcgaagcctgcatttaatcattgagatg
cctgtgaatttaacgaaccgtgtggaatacgtcaaagcagaaattcaaatccggacaatc
gcgatggatttctgggcgagccttgaacataaaatttattataaattgaacaatgacgtt
cctaagcaattaacagatgagctgaaagaagccgcggagattgcccattacctagatgag
aaaatgctggggattaagaaagaagtggattaa

DBGET integrated database retrieval system