KEGG   Bacillus subtilis subsp. subtilis 168: BSU38490
Entry
BSU38490          CDS       T00010                                 

Symbol
menA
Name
(RefSeq) 1,4-dihydroxy-2-naphthoate octaprenyltransferase
  KO
K02548  1,4-dihydroxy-2-naphthoate polyprenyltransferase [EC:2.5.1.74]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BSU38490 (menA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsu01006]
    BSU38490 (menA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.74  1,4-dihydroxy-2-naphthoate polyprenyltransferase
     BSU38490 (menA)
Prenyltransferases [BR:bsu01006]
 Compound prenylation
  DHNA octaprenyltransferase
   BSU38490 (menA)
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 937356
NCBI-ProteinID: NP_391728
Pasteur: BG10552
BSORF: BG10552
UniProt: P39582 A0A6M4JQJ8
Position
complement(3950726..3951661)
AA seq 311 aa
MNQTNKGEGQTAPQKESMGQILWQLTRPHTLTASFVPVLLGTVLAMFYVKVDLLLFLAML
FSCLWIQIATNLFNEYYDFKRGLDTAESVGIGGAIVRHGMKPKTILQLALASYGIAILLG
VYICASSSWWLALIGLVGMAIGYLYTGGPLPIAYTPFGELFSGICMGSVFVLISFFIQTD
KINMQSILISIPIAILVGAINLSNNIRDIEEDKKGGRKTLAILMGHKGAVTLLAASFAVA
YIWVVGLVITGAASPWLFVVFLSVPKPVQAVKGFVQNEMPMNMIVAMKSTAQTNTFFGFL
LSIGLLISYFR
NT seq 936 nt   +upstreamnt  +downstreamnt
atgaaccaaacaaataagggtgagggtcagacagcgccgcaaaaagaaagcatggggcag
atcctttggcagttaacccgtcctcatacgttaaccgcatcgtttgtgcctgtgctgctc
ggaaccgttttggcgatgttttatgtgaaggttgatctgctgctgtttttggctatgctg
ttttcttgcctatggatccagatcgcgacgaacttatttaatgaatactatgattttaaa
cgcggattagatacagcagaatcagtcggaatcggaggggccattgtacgccacggaatg
aagcctaaaacgattttgcaattagctcttgcctcatacgggattgccattttgctcggt
gtctatatttgtgccagcagcagctggtggcttgcgctgatcggccttgtcggcatggcg
atcggctacctgtatacaggcgggccgctgccgattgcgtacacgccgttcggtgaatta
ttctcaggcatttgcatgggttcggtgtttgtgctgatttcgtttttcattcagacagat
aagatcaatatgcagagcattttgatttccatcccgattgcgattcttgtcggcgcgatt
aacctgtcgaacaacattcgtgatattgaagaggacaaaaaaggcggacgcaaaacattg
gcgattttgatggggcataagggagctgttactctgttagctgcgtcgtttgccgtcgct
tatatctgggttgtcggcttggttattaccggtgccgcaagcccatggctgtttgtcgtc
tttttgagcgtgcctaagccggttcaggcagtgaagggcttcgtccagaacgaaatgccg
atgaatatgattgtcgcaatgaaatcaacagcccaaacaaatacatttttcggattcctg
ctctcgatcggattattgatcagctatttccgataa

DBGET integrated database retrieval system