KEGG   Bacillus subtilis subsp. subtilis 168: BSU38499
Entry
BSU38499          CDS       T00010                                 

Symbol
ywzH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3687 Syndecan
Other DBs
NCBI-GeneID: 8303014
NCBI-ProteinID: YP_003097795
UniProt: C0H3T3 A0A6M3ZIG8
Position
3952108..3952257
AA seq 49 aa
MLQLMKQLYEKPAVKWTCHTGFYLMILLVLFFMYGFHTANTGSYIYNDF
NT seq 150 nt   +upstreamnt  +downstreamnt
atgctgcaattaatgaaacagctgtatgaaaaacccgctgtcaagtggacatgtcataca
ggcttttatttgatgatactgcttgttttgttttttatgtatggttttcacaccgcgaat
accggttcatatatttataacgatttctaa

DBGET integrated database retrieval system