KEGG   Bacillus subtilis subsp. subtilis 168: BSU38530
Entry
BSU38530          CDS       T00010                                 

Symbol
dltD
Name
(RefSeq) poly D-alanine transfer protein DltD
  KO
K03740  D-alanine transfer protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01503  Cationic antimicrobial peptide (CAMP) resistance
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU38530 (dltD)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BSU38530 (dltD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU38530 (dltD)
Antimicrobial resistance genes [BR:bsu01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    BSU38530 (dltD)
SSDB
Motif
Pfam: DltD
Other DBs
NCBI-GeneID: 937362
NCBI-ProteinID: NP_391732
Pasteur: BG10548
BSORF: BG10548
UniProt: P39578 A0A6M3ZHH5
Position
3955223..3956401
AA seq 392 aa
MKKRFFGPIILAFILFAGAIAIPSSWLTGFITDKRVKESATALNPSMFQGLYLQDQMLKD
PTYLPIYGSSELSRLDEFHPSNYFQVNNEGFTPYLVGKGGSQSLIHSLNFAAHMDQLKGK
KIVFIVSPQWFIKRGSDEQHFAPNYSALQGLDLAFNDQIDPEIKKKMMKRMLRFKAVQND
AILSELYKAMVNGQTWKVNALKPAAKVYYSMLEKKDLYYSTTESSGPKRYISQSVKDKSW
SELNKLADQSGKRHSGSNDFHIDNPVYKKLKPKVPKLKGKNKGRSYAVSPEYGDFEMMLD
ILKDAGAEPMFVTIPVNGKWYDYTGFPKKGRTDYYKKVNKQIRAKGFQVADFSGHEYDPY
FMKDTIHIGWKGWVYVDKAIDEFYKTGKVTSS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaaaaagcgttttttcggtccaattattttggcgtttattctattcgcaggcgccatc
gcaattccatcttcatggctgacaggcttcatcaccgataagcgtgtgaaagagtcagca
acagccttgaatccgagtatgtttcaagggctatatttacaagatcagatgctcaaagat
ccgacatatcttccgatttacgggtcttctgagctttctcggctggacgagttccaccca
tctaattattttcaggtaaacaatgagggattcacgccataccttgtcggcaaaggcgga
tcccagtcattgattcattctttaaacttcgctgcccacatggatcagctgaagggcaaa
aaaatcgtattcatcgtgtctccgcaatggtttattaagcgcgggtctgatgaacagcat
ttcgcgccgaactattctgcgctgcaagggcttgatttggcatttaacgatcagatcgat
cctgaaattaaaaagaaaatgatgaaacgcatgcttcgctttaaggctgtgcaaaacgat
gccattctttctgagctgtacaaagcaatggtaaacggtcagacgtggaaagtgaacgcg
ctgaagccggcggcgaaagtgtattacagcatgctggaaaagaaagatctgtattattca
acgacagaatcatccgggccaaagcgctatatctcgcagtcagtaaaggataagtcatgg
tctgaattgaataaactagcggatcaatcgggcaaacgccactccggttctaacgatttt
cacatcgacaaccctgtctataaaaagctgaagccgaaagtgcctaagctgaaagggaaa
aacaaaggaagatcgtatgcggtgtcaccggaatatggcgactttgaaatgatgctcgat
atcctgaaggatgcgggcgcagagcctatgtttgtcaccattcctgttaacgggaaatgg
tacgattacacgggcttcccgaaaaaaggacgcactgactattacaaaaaggtaaataaa
caaatcagagcgaagggcttccaggttgctgatttctcagggcatgaatatgacccgtat
ttcatgaaagacaccattcacatcggctggaaaggctgggtgtatgtcgataaagcaatt
gacgaattttataaaaccggaaaagtcacttcatcctga

DBGET integrated database retrieval system