KEGG   Bacillus subtilis subsp. subtilis 168: BSU38540
Entry
BSU38540          CDS       T00010                                 

Gene name
dltE
Definition
(RefSeq) oxidoreductase
  KO
K14189  uncharacterized oxidoreductase [EC:1.-.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU38540 (dltE)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     BSU38540 (dltE)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Polysacc_synt_2 F420_oxidored Pyr_redox RmlD_sub_bind Sacchrp_dh_NADP GDP_Man_Dehyd NAD_binding_7 TrkA_N NAD_binding_10
Other DBs
NCBI-GeneID: 937369
NCBI-ProteinID: NP_391733
Pasteur: BG10547
BSORF: BG10547
UniProt: P39577 A0A6M3ZHQ3
Position
3956492..3957250
AA seq 252 aa
MKMTNNTVLITGGSAGIGLELAKRLLELGNEVIICGRSEARLAEAKQQLPNIHTKQCDVA
DRSQREALYEWALKEYPNLNVLVNNAGIQKEIDFKKGTEELFVDGDEIELNFQAPVHLSA
LFTPHLMKQPEAAIVQVTSGLAFNPLAVYPVYCATKAALHSFSLTLRHQLRDTSVEVIEM
APPMVDTGLNQKSRDKQGLTYRGISSEEYVQYFLDGLKEGKQEITNERVEGLRDATRADY
DRLFEQMNTQEN
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaagatgacaaataatacggttttaatcacagggggttctgctggcatcgggcttgaa
ctggccaagcgcctgctggaacttggcaatgaagttatcatttgcggacgcagcgaagca
cgtcttgcagaagcgaagcagcagctcccaaacatccatacaaagcaatgtgatgttgca
gaccgttcgcagcgggaagcattgtatgaatgggctttaaaggaatatccgaacttgaat
gttctcgtcaacaacgccggcattcaaaaggaaattgactttaaaaaagggacagaggag
ctttttgtggacggtgatgaaattgaacttaatttccaagcgcctgtccatttatccgcc
cttttcacacctcatttgatgaagcagcccgaggcggcaatcgttcaggtcacatccggg
cttgcgtttaacccgttagctgtttatccggtgtactgcgcaacaaaagcggcacttcac
tcgttctcgcttacgctcagacaccagctccgcgacacgagcgtggaagtgattgaaatg
gcaccgcctatggtggacacgggcttaaaccaaaaatcacgcgataaacaaggcctgacg
taccggggcatttcatctgaagaatatgttcaatatttcttggacggcttgaaggaaggc
aaacaggagattacaaatgaacgtgttgaaggtcttcgggatgccactcgcgccgattat
gacaggttattcgagcaaatgaacacgcaggagaattaa

DBGET integrated database retrieval system