KEGG   Bacillus subtilis subsp. subtilis 168: BSU38550
Entry
BSU38550          CDS       T00010                                 

Gene name
ywaA
Definition
(RefSeq) branched-chain-amino acid aminotransferase 2
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00280  Valine, leucine and isoleucine degradation
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
bsu01240  Biosynthesis of cofactors
Module
bsu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bsu_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
bsu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU38550 (ywaA)
   00280 Valine, leucine and isoleucine degradation
    BSU38550 (ywaA)
   00290 Valine, leucine and isoleucine biosynthesis
    BSU38550 (ywaA)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU38550 (ywaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU38550 (ywaA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     BSU38550 (ywaA)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class IV
   BSU38550 (ywaA)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 937372
NCBI-ProteinID: NP_391734
Pasteur: BG10546
BSORF: BG10546
UniProt: P39576 A0A6M3ZHM6
Position
3957391..3958482
AA seq 363 aa
MTKQTIRVELTSTKKPKPDPNQLSFGRVFTDHMFVMDYAADKGWYDPRIIPYQPLSMDPA
AMVYHYGQTVFEGLKAYVSEDDHVLLFRPEKNMERLNQSNDRLCIPQIDEEQVLEGLKQL
VAIDKDWIPNAEGTSLYIRPFIIATEPFLGVAASHTYKLLIILSPVGSYYKEGIKPVKIA
VESEFVRAVKGGTGNAKTAGNYASSLKAQQVAEEKGFSQVLWLDGIEKKYIEEVGSMNIF
FKINGEIVTPMLNGSILEGITRNSVIALLKHWGLQVSERKIAIDEVIQAHKDGILEEAFG
TGTAAVISPVGELIWQDETLSINNGETGEIAKKLYDTITGIQKGAVADEFGWTTEVAALT
ESK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgactaaacaaacaattcgcgttgaattgacatcaacaaaaaaaccgaaaccagaccca
aatcagctttcgttcggaagagtgtttacagaccacatgtttgtaatggactatgccgca
gataaaggttggtacgatccaagaatcattccttatcaacccttatcaatggatccggct
gcaatggtctatcactacggccaaaccgtgtttgaagggttaaaggcttacgtgtcagag
gatgaccatgttctgcttttcagaccggaaaaaaatatggaacgcctgaatcaatcaaac
gaccgcctctgcatcccgcaaattgatgaagaacaggttcttgaaggcttaaagcagctt
gtcgcaattgataaagactggattccaaatgcggagggcacgtccctttacatccgtccg
ttcatcatcgcaaccgagcctttccttggtgttgcggcatctcatacgtataagctcttg
atcattctttctccggtcggctcttattacaaagaaggcattaagccggtcaaaatcgct
gttgaaagtgaatttgtccgtgcggtaaaaggcggaacaggaaatgccaaaaccgcagga
aactatgcttcaagcttaaaagcgcagcaggtagccgaagagaaaggattttctcaagta
ctctggctggacggcattgagaagaaatacatcgaagaagtcggaagcatgaacatcttc
ttcaaaatcaacggtgaaatcgtaacaccgatgctgaacgggagcatcctggaaggcatt
acgcgcaattcagtcatcgccttgcttaagcattggggccttcaagtttcagaacgaaaa
attgcgatcgatgaggtcatccaagcccataaagacggcatcctggaagaagccttcgga
acaggtacagcagctgttatttccccagtcggcgagctgatctggcaggatgaaacactt
tcgatcaacaacggtgaaacaggagaaatcgcaaaaaaactatatgacacgattacaggc
attcaaaaaggcgctgtcgcagacgaattcggatggacgaccgaagtcgcagcgctgact
gaaagcaagtaa

DBGET integrated database retrieval system