KEGG   Bacillus subtilis subsp. subtilis 168: BSU38560
Entry
BSU38560          CDS       T00010                                 

Gene name
licH
Definition
(RefSeq) 6-phospho-beta-glucosidase
  KO
K01222  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU38560 (licH)
   00500 Starch and sucrose metabolism
    BSU38560 (licH)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BSU38560 (licH)
SSDB
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Other DBs
NCBI-GeneID: 937373
NCBI-ProteinID: NP_391735
Pasteur: BG11350
BSORF: BG11350
UniProt: P46320 A0A6M3ZK97
Position
complement(3958516..3959844)
AA seq 442 aa
MTKGLKIVTIGGGSSYTPELVEGFIKRYDELPVRELWLVDIPEGEEKLNIVGTLAKRMVE
KAGVPIDIHLTLDRRKALKDADFVTTQFRVGLLQARAKDERIPLKYGVIGQETNGPGGLF
KGLRTIPVILEIAKDIEELCPNAWLVNFTNPAGMVTEALLRYSNLKKVVGLCNVPIGIKM
GVAKALDVDVDRVEVQFAGLNHMVFGLDVFLDGVSVKEQVIEAMGDPKNAMTMKNISGAE
WEPDFLKALNVIPCGYHRYYFKTKEMLEHELEASQTEGTRAEVVQKVEKELFELYKDPNL
AIKPPQLEKRGGAYYSDAACNLISSIYNDKHDIQPVNTINNGAIASIPDDSAVEVNCVMT
KTGPKPIAVGDLPVSVRGLVQQIKSFERVAAEAAVTGDYQTALLAMTINPLVPSDTVAKQ
ILDEMLEAHKAYLPQFFNKIEA
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgacaaaaggattgaagattgtaacgattggcggaggttcaagctatacgcccgagcta
gtggaggggttcattaaacggtatgatgagctgcctgtccgtgaattatggcttgtcgat
atccccgagggcgaagaaaagctgaatattgtcggcacactcgccaaacggatggttgaa
aaagctggcgtcccgattgacattcatcttacgctcgaccggagaaaggcgctgaaagac
gcagactttgtcacgacccaattccgcgtcggacttttgcaggcaagagcaaaggatgag
cgcattccgctaaaatacggagtgataggccaggaaacaaacggcccgggaggtctgttt
aaaggattgcgcacaattccggtcatccttgagatcgcaaaggacatagaagagctttgc
ccgaacgcttggcttgttaacttcacaaaccctgccggcatggtaacagaagccttgctt
cgctactccaacctgaagaaagtcgtcggtctttgcaatgttccaatcggcatcaaaatg
ggcgtagccaaagcgcttgatgtagatgtggaccgcgtagaagtccaatttgccggactg
aaccatatggtattcgggctggatgttttcttggacggcgtaagtgtgaaggagcaagtc
atcgaggcgatgggcgacccgaaaaacgcgatgacgatgaaaaatatctcaggcgccgaa
tgggaaccggatttcttaaaagcgctcaatgtcatcccttgcggctatcaccgttactat
tttaaaacaaaagagatgctggagcacgaactggaagcatcacaaacggagggcacccgc
gctgaagtcgtacagaaggtcgaaaaagagctgttcgagctttataaagatccaaacctt
gcgatcaaaccgccgcagctggaaaaacggggcggagcttactacagtgatgcagcatgt
aacttaatcagctccatttataatgataaacatgacattcagccggtgaacacgatcaat
aatggtgcaatagcgagtattccagacgattccgcagttgaagtgaactgtgtgatgacg
aaaaccggccctaagccaattgctgtcggcgacttgccggtgtctgtccgcggccttgtc
cagcaaatcaaatcctttgaacgtgtcgcggcagaagcggcagttacaggtgactatcaa
actgcgctccttgccatgacgattaacccgcttgtcccgtccgatactgtggccaaacag
attttagacgaaatgctagaggcgcacaaagcgtatctgccgcagtttttcaacaaaatt
gaagcgtaa

DBGET integrated database retrieval system