KEGG   Bacillus subtilis subsp. subtilis 168: BSU38570
Entry
BSU38570          CDS       T00010                                 

Gene name
licA
Definition
(RefSeq) PTS system-lichenan-specific transporter subunit IIA
  KO
K02759  cellobiose PTS system EIIA component [EC:2.7.1.196 2.7.1.205]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU38570 (licA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU38570 (licA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38570 (licA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     BSU38570 (licA)
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     BSU38570 (licA)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU38570 (licA)
SSDB
Motif
Pfam: PTS_IIA MAS20 YfdX Adeno_terminal HemY_N NikR_C
Other DBs
NCBI-GeneID: 937374
NCBI-ProteinID: NP_391736
Pasteur: BG11349
BSORF: BG11349
UniProt: P46319 A0A6M4JQJ7
Position
complement(3959841..3960173)
AA seq 110 aa
MNEEMEQIIFQIILHGGNGRSSAMEAIAAAKSGDAEEARKKLQDAAEELSKAHHYQTELI
QNEAGGEKTEMTLLMVHAQDHLMNAMTVKDMAAEIIELYEKITEQRGASI
NT seq 333 nt   +upstreamnt  +downstreamnt
gtgaatgaggaaatggaacaaatcatttttcaaatcatccttcacggaggaaacggtagg
agctccgcaatggaggccattgccgctgcgaaaagcggtgacgcagaagaagcgcggaaa
aagcttcaagacgctgctgaagaattgtcaaaagcccatcattatcagacagagctgatc
caaaatgaagcgggcggagaaaagacggaaatgacgcttctgatggttcatgcacaggat
catttaatgaatgcaatgacagtgaaggatatggctgcagagatcattgagttatatgaa
aaaatcaccgagcaaaggggagcaagcatatga

DBGET integrated database retrieval system