KEGG   Bacillus subtilis subsp. subtilis 168: BSU38580
Entry
BSU38580          CDS       T00010                                 

Gene name
licC
Definition
(RefSeq) PTS system-lichenan-specific transporter subunit IIC
  KO
K02761  cellobiose PTS system EIIC component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU38580 (licC)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU38580 (licC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38580 (licC)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU38580 (licC)
SSDB
Motif
Pfam: PTS_EIIC
Other DBs
NCBI-GeneID: 937375
NCBI-ProteinID: NP_391737
Pasteur: BG11348
BSORF: BG11348
UniProt: P46317 A0A6M4JQK6
Position
complement(3960192..3961550)
AA seq 452 aa
MNKVNQILEEKVMPIAGRIAGQRHLQALRDGIILTMPLIIIGSFFLIIGNLPIPGYAEFM
AKTFGSSWSEKLAYPVDATFEIMGLVAAFGIAYRLAEKYGVDALSAGAISLAAFLLATPY
QVPFMPDGATKEIMVGGGIPLSLMGSKGLFVAMIIAMVSTEIYRLIIQRNLVFKMPDGVP
PAVSKSFVALIPGFAVIFLIWAARLIVEATPFESLHNIVSVLLGTPLSILGGSLGGSLVA
EAVKMLLWACGLHGANIVGGVMAPIWYGAMDANRIAFQAGEELPKIFTQQFFDIWVNIGG
SGATLALVVTMFLRARSKQMKQLGKLAVGPAIFNINEPIIFGMPIVMNPMLLLPFIITPL
VTVTLTYIGMSTGLVAKPAGIAVPWTMPPIFSGYLATGGKVSGAVMQAINIAVSFVVYYP
FFRMWDKQKLKEENDLELVQTPAATDDKEAAL
NT seq 1359 nt   +upstreamnt  +downstreamnt
gtgaataaagtcaatcagatcttagaagaaaaggtcatgcctatagcgggaagaattgcg
ggacagcgtcatttgcaggcgctgcgtgatggtatcatcctcacgatgcccctgattatc
atcggttcctttttcctcatcattggcaacctcccgatcccgggatacgctgagtttatg
gcaaaaacgtttggcagctcctggtctgaaaaactggcctacccagtcgacgcgaccttt
gaaattatgggtcttgtcgccgcgttcggcattgcctaccggctcgccgagaaatacggt
gttgatgccttgtcggccggagccatttcccttgcggcatttttattagcaacaccttat
caagtgccgtttatgccggatggcgcgacgaaagaaatcatggttggcggcgggattccg
ctttcgctcatgggaagcaaaggcttatttgtcgccatgattatcgcaatggtgtccaca
gagatttaccgccttattatccagcgcaatttagtcttcaaaatgccggacggtgtcccg
ccggcggtaagcaagtcatttgtcgcgttaatccccggctttgccgtcatcttcctaatt
tgggcagcccggctgattgttgaagcgacaccgtttgaaagccttcataatattgtaagc
gttttattggggactccgctttccattctgggaggaagccttggaggaagccttgtcgcc
gaagccgtcaaaatgcttttatgggcctgcggccttcacggtgcaaacattgttggcggc
gtcatggcaccgatttggtacggcgcaatggatgccaaccggatcgcattccaagccggt
gaggagcttcctaagattttcacccagcaatttttcgatatctgggtcaatattggcgga
agcggcgccacattggcactggttgtcacgatgttcctgcgcgcccgaagcaaacaaatg
aagcagctcgggaagcttgcggtcggcccggccatcttcaatattaacgaaccgattata
ttcggaatgccgatcgtcatgaacccaatgctcttacttccgtttatcatcacgccgctt
gtcacagtgacactcacgtacatcggaatgagcaccggccttgtcgccaaaccggcgggt
atcgcagtgccgtggaccatgccgccgatcttttcaggctacttggcgacaggaggaaaa
gtctcaggcgcggtcatgcaagccattaatattgccgtgtcctttgttgtctactatcca
ttcttcagaatgtgggataagcagaagctgaaagaagaaaacgatctggagctggtccaa
acgcctgcagcaacagatgacaaagaagcggctctgtag

DBGET integrated database retrieval system