KEGG   Bacillus subtilis subsp. subtilis 168: BSU38590
Entry
BSU38590          CDS       T00010                                 

Gene name
licB
Definition
(RefSeq) PTS system-lichenan-specific transporter subunit IIB
  KO
K02760  cellobiose PTS system EIIB component [EC:2.7.1.196 2.7.1.205]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU38590 (licB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU38590 (licB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38590 (licB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     BSU38590 (licB)
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     BSU38590 (licB)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU38590 (licB)
SSDB
Motif
Pfam: PTS_IIB
Other DBs
NCBI-GeneID: 937379
NCBI-ProteinID: NP_391738
Pasteur: BG11347
BSORF: BG11347
UniProt: P46318 A0A6M3ZIH7
Position
complement(3961566..3961874)
AA seq 102 aa
MNILLVCAAGMSTSLLVSKMEKSAQEQGKDYTIWAVSGDSVQNHIDKADVLLLGPQVRYM
LPQLKKLGESKGVPVDVINTVHYGTCNGAEVLKSAEQLGHVS
NT seq 309 nt   +upstreamnt  +downstreamnt
atgaatatattactcgtttgtgcagcaggcatgtctactagcttactggtgagcaagatg
gaaaaaagtgcgcaggaacagggaaaagactataccatttgggcagtttcaggcgattct
gtacaaaatcatatcgataaagcggatgtattgcttctcggtccgcaagtccgttacatg
cttccgcagctcaaaaaattaggagagtcaaagggggttccggtagacgtcattaatacc
gtccattatggaacgtgcaatggggcggaagtgctgaaatcagctgaacagcttggacat
gtgtcatag

DBGET integrated database retrieval system