KEGG   Bacillus subtilis subsp. subtilis 168: BSU38600
Entry
BSU38600          CDS       T00010                                 

Gene name
licR
Definition
(RefSeq) licABCH operon regulator
  KO
K03491  lichenan operon transcriptional antiterminator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU38600 (licR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   BglG family
    BSU38600 (licR)
SSDB
Motif
Pfam: PRD PTS_EIIA_2 HTH_11 Mga HTH_Mga HTH_DeoR PuR_N PTS_IIB HTH_20 HTH_10
Other DBs
NCBI-GeneID: 937383
NCBI-ProteinID: NP_391739
Pasteur: BG11346
BSORF: BG11346
UniProt: P46321 A0A6M3ZHF7
Position
complement(3962003..3963928)
AA seq 641 aa
MLHGRLRDILRLLMAAEAPVTSSFFAAQLNVTTRTVRNDIKELQGVLSGHGAFVQSVRGS
GYKLRIDDEQVFRTLLQDEFQQKKGLPVLPEERMAYLMKRLLLADHYLKLDELAEELFIS
KSTLQTDLKEVKKRLLPYRIVMETRPNYGFKLRGDEVQMRYCMAEYIVDERETEIDVLNE
KADILPKEEIEIIRSAILKKMKNDRIPLSNMGLNNLIIHIAIACKRIRTENYVSLFPKDM
DHILHQKEYQAAEAIVKELESKLSVTFPKDETAYITMHLLGTKRMTQSQCGEDTFSIEEE
TDQLTLAMIKAVDRELKLGILHDKELKIGLALHMKPAISRNRYGMNLRNPMLAAIKEHYP
LAFEAGIIAGIVIKEQTGIEIHENEIGYLALHFGAAIERKKTESPPKRCIIVCASGAGSA
QLLREKLRSHFGKRLDILGTAEYYSLDQMSYESIDFVISTIPIKKELPVPVLKVNTILGG
TDFTKIESILSDEKEKANRYLKKELVFFQEDLRSKEEVIQFLGQKVVECGFADEEIIDSI
FEREDMSPTCFGNLVAIPHPLVPQTKTTFWAVCTLKKPIDWESQRVQFVCLLCVEKENKA
DLQSMYKLLGSILDDPAAMNQLIKCRSYQELSDVFDQKMLS
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgcttcatgggcgactacgtgatattctgcgcttgctgatggcggctgaagccccggtg
acaagttcgttttttgccgcgcaattaaacgtaacgacgcggacagtccgcaatgatata
aaggaacttcaaggtgtgctaagcggccacggtgcctttgtacaatctgtaagaggctcc
ggctacaagctccgcattgatgacgagcaagtattcagaacactgctgcaagatgaattt
cagcaaaaaaagggcctgccggtattgccggaggagagaatggcctatcttatgaaacgt
ctgctgctggcggaccattatctcaagctcgatgaacttgctgaagaactatttatctca
aaatctacactccaaacggatttaaaggaagtaaagaaacgtctgctgccttaccgcatc
gtcatggaaacacgtccgaattacggcttcaagctgcgcggggacgaggtgcagatgagg
tactgcatggcggagtacattgttgatgaaagagaaacggagatagatgttttaaatgaa
aaggctgatattttgccaaaagaagaaattgagatcatccgttccgccatcttgaaaaaa
atgaaaaacgaccgcatccctctgtccaacatgggactgaataacctcattatccatatc
gctatcgcctgtaaacggatcagaacggaaaactatgtttctcttttcccgaaagatatg
gatcatatcctgcatcaaaaggagtaccaggctgcagaagccatcgtaaaagagctggaa
tcaaagctttccgttacgtttccgaaagacgagacggcctacatcaccatgcatctcctt
ggcacaaaacgaatgacacaatcacaatgcggagaggacacattttcaatagaagaggaa
accgatcagctgacacttgccatgatcaaagctgttgatcgtgaactgaagcttggcatc
ctgcatgacaaagagctgaaaatcggcttggcactgcatatgaagccggcgatcagccgc
aaccgatacggcatgaatcttcgaaatccgatgctggcagcgatcaaggaacattatcca
ctcgcttttgaagccgggatcattgccggaatcgtgataaaggaacaaacgggtattgag
attcatgaaaacgaaattggatatttggctctccactttggcgccgcgattgaacgaaaa
aaaacagaaagcccgccgaaacgctgtatcattgtatgcgcatcgggagccggaagcgcc
cagcttctgcgcgaaaaactgcgttcccatttcggcaagcggctcgatattcttggaacg
gctgagtattatagtcttgatcaaatgtcctacgaatcaattgattttgtcatcagcacc
attccgattaaaaaagagctccctgtaccagtactgaaggttaacaccatcttaggcgga
actgactttacaaaaatagaatctattctgagtgatgaaaaggaaaaagccaatcgctac
ctaaaaaaagaactcgttttttttcaggaggatctgcgctcaaaagaagaagtgattcaa
tttttagggcagaaagtggtcgaatgcggctttgccgatgaagaaatcatagattccatt
tttgaaagagaagacatgtcgccaacgtgttttggcaatcttgttgccatcccgcacccg
cttgttccgcagacgaaaacaacgttttgggccgtttgtacgctcaaaaaaccgatcgat
tgggagagtcagcgagttcaatttgtctgtctgctttgtgtcgaaaaggagaacaaagcg
gatttacaaagcatgtataaactgcttggcagcattttggatgacccggcggcgatgaac
cagctgatcaaatgccgttcatatcaagagctttcggatgtgtttgaccaaaaaatgctg
agctga

DBGET integrated database retrieval system