KEGG   Bacillus subtilis subsp. subtilis 168: BSU38610
Entry
BSU38610          CDS       T00010                                 

Symbol
yxzF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937390
NCBI-ProteinID: NP_391740
Pasteur: BG14169
BSORF: BG14169
UniProt: O32283 A0A6M3ZL21
Position
complement(3964091..3964249)
AA seq 52 aa
MVEKKEGRIGALKKMIKTVIKWAPVIYPIVRKIMKDRKASKQKNMSASRTAG
NT seq 159 nt   +upstreamnt  +downstreamnt
atggttgagaaaaaagaagggagaatcggagctttgaaaaagatgatcaaaaccgttatc
aaatgggcgccggtcatttacccgattgttcgaaaaatcatgaaggaccgcaaggcgtct
aaacaaaagaatatgtccgcatctagaacagccggctga

DBGET integrated database retrieval system