KEGG   Bacillus subtilis subsp. subtilis 168: BSU38620
Entry
BSU38620          CDS       T00010                                 

Symbol
yxlJ
Name
(RefSeq) 3-methyladenine DNA glycosylase
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BSU38620 (yxlJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU38620 (yxlJ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     BSU38620 (yxlJ)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BSU38620 (yxlJ)
 Prokaryotic type
     BSU38620 (yxlJ)
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-GeneID: 937391
NCBI-ProteinID: NP_391741
Pasteur: BG12555
BSORF: BG12555
UniProt: P94378 A0A6M4JQI5
Position
complement(3964278..3964868)
AA seq 196 aa
MTREKNPLPITFYQKTALELAPSLLGCLLVKETDEGTASGYIVETEAYMGAGDRAAHSFN
NRRTKRTEIMFAEAGRVYTYVMHTHTLLNVVAAEEDVPQAVLIRAIEPHEGQLLMEERRP
GRSPREWTNGPGKLTKALGVTMNDYGRWITEQPLYIESGYTPEAISTGPRIGIDNSGEAR
DYPWRFWVTGNRYVSR
NT seq 591 nt   +upstreamnt  +downstreamnt
gtgacgagagaaaaaaatccgctgcccatcacgttttatcaaaaaaccgctcttgagctt
gccccatcgcttctgggctgccttcttgtaaaagaaacagacgaaggcacagcgtcaggc
tatattgtggaaacagaggcctatatgggggctggagacagagcggcccacagctttaac
aaccgccggacgaagcggactgagatcatgtttgcagaagctgggcgggtatatacatac
gtgatgcacacccatacattgctgaatgtcgttgcggcggaagaggatgtcccgcaagca
gtattaatcagggcgattgagccgcatgaaggccagctgttaatggaggagagaaggccg
ggcaggagtccgagggaatggacaaacggaccaggaaagctgacgaaagcgcttggcgtc
acgatgaatgactacggacgctggatcacggaacagccgctttacatcgaaagcgggtac
acaccggaagcaatttcaaccggcccgcgcatcggcattgacaacagcggggaggcacgc
gattatccatggcgtttctgggtgacgggaaacaggtacgtgtcgcgttag

DBGET integrated database retrieval system