KEGG   Bacillus subtilis subsp. subtilis 168: BSU38630
Entry
BSU38630          CDS       T00010                                 

Gene name
katX
Definition
(RefSeq) catalase X
  KO
K03781  catalase [EC:1.11.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00380  Tryptophan metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU38630 (katX)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BSU38630 (katX)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BSU38630 (katX)
SSDB
Motif
Pfam: Catalase Catalase-rel
Other DBs
NCBI-GeneID: 937399
NCBI-ProteinID: NP_391742
Pasteur: BG11945
BSORF: BG11945
UniProt: P94377 A0A6M4JQQ1
Position
3964997..3966640
AA seq 547 aa
MKDDHQNKQHQSNAQGSEEAFSHKTSGKNESEDTLTNRQGHPVTDNQNVRTVGNRGPTTL
ENYDFLEKISHFDRERIPERVVHARGAGAHGYFEAYGSFGDEPISTYTRAKLFQEKGKKT
PAFVRFSTVNHGKHSPETLRDPRGFAVKLYTEDGNWDLVGNNLKIFFIRDPLKFPDLVHA
FQPDPVTNIQDGERIFDFISQSPEATHMITFLFSPWGIPANYRQMQGSGVHAYKWVNEEG
KAVLVKYHFEPKQGIRNLTQKEAEEIQGKNFNHATQDLYDAIENGDYPEWEVYAQIMSDD
EHPELDFDPLDPTKLWYKDDFPWKPIGKLVLNKNPENYHAEVEQASFGTGVLVDGLDFSD
DKLLQGRTFAYSDTQRYRVGANYLQLPINSPKKHVATNQEGGQMQYRVDRAEGQNPHVNY
EPSIMGGLKEAKQDGKDHTPHVEGDVKREAIDRTNNFGQAGETYRRFTEFERNELITNLV
NTLSTCRKEIQDQMIENFTKADPDYGKRVAEGLKKVSENNSNGPIGTTETEQAAKQAEQE
SHPSDPY
NT seq 1644 nt   +upstreamnt  +downstreamnt
ttgaaagatgatcatcaaaacaagcagcaccaatcaaatgcccaagggagcgaggaagcg
ttttctcataagacatccgggaaaaacgagtcagaggataccttaacgaataggcagggg
catcctgttactgacaaccagaatgtgagaaccgtcgggaatagagggcctacaacactt
gagaactatgattttctcgaaaagatcagccacttcgaccgggaacgcatcccagagcgg
gttgttcatgccaggggagcaggtgcacatggatattttgaagcgtacggaagcttcgga
gacgaaccgatttcaacatacacaagggccaagctctttcaggaaaaaggcaagaaaaca
ccggcatttgtccgtttttcaactgtgaatcatggaaaacactcgcctgaaacattgaga
gacccgcgcggttttgctgtaaagctatatacagaagacggaaactgggatttggtcgga
aacaacctgaaaatcttttttatccgcgacccgctgaaatttccggatcttgtacacgca
tttcagcctgatccagtgacaaacatccaggatggtgaacgtatcttcgatttcatttct
caatctcctgaagcgacacacatgatcaccttcttgttttcgccttggggcattccggcc
aactaccggcaaatgcagggttcaggcgtacatgcctataaatgggtgaatgaggagggc
aaggccgttctcgtgaaataccattttgaaccgaagcagggcatccgcaacctgacacag
aaggaagcagaagagattcaagggaaaaactttaaccatgccacacaggatctatatgac
gcgattgaaaatggcgattatccagagtgggaagtatatgctcaaatcatgagcgatgat
gagcatcctgaactggactttgatcctcttgatccaacaaaactgtggtataaagacgat
ttcccatggaaaccgatcggcaaattggttctgaacaaaaatccggaaaactaccatgcg
gaagtggagcaagcttcatttggaacgggagtgcttgtcgacgggcttgatttttcagac
gacaaattgctccaggggcgtacgtttgcctactctgatacgcagcgctaccgtgtaggc
gcaaattacctgcagcttccgatcaactcgccgaaaaagcatgtcgccaccaaccaggaa
ggcgggcaaatgcaatatcgggtcgatagagcagaaggacaaaacccgcacgtcaactac
gagccatccattatgggcgggctgaaggaagcgaagcaagacggaaaagaccatacgccg
catgtcgaaggtgatgtaaagcgtgaagcgattgacagaacaaacaacttcggacaggct
ggagaaacgtaccggagatttactgaatttgagcggaacgaattgattacgaatttggtg
aatacgctttctacgtgccgaaaagaaattcaggatcaaatgattgagaatttcacaaaa
gctgatcctgactacggaaaacgcgtagcagaagggctaaaaaaggtctccgaaaacaac
agcaacgggccgatcggcacaactgaaacggaacaggctgcaaagcaggctgaacaggag
agtcatccgtctgatccgtattaa

DBGET integrated database retrieval system