KEGG   Bacillus subtilis subsp. subtilis 168: BSU38640
Entry
BSU38640          CDS       T00010                                 

Gene name
yxlH
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 937392
NCBI-ProteinID: NP_391743
Pasteur: BG12554
BSORF: BG12554
UniProt: P94376 A0A6M3ZHI5
Position
3966745..3967947
AA seq 400 aa
MELQQDLIPQKKTIGALDHAVFLCMVFCFWFSGYIYVPVFSLYLEDLHFSYGAIGIILGS
YGVTQILLRFPLGLLSDILFSLRKQLLIAGFGFSVLSSLLFLMFDSFFFVLAARLFAGIT
ASTWVMATILYAHYFNNGNASKAMGIMQFFTVMPQFASIVFCGLAAAHLGRQVPFWMALA
ASAAGLVICCFIQDPSAPPANRGTIRVNQYIKDTLRLPKLKLFTILSMTAHAVLFITVFG
FTPLYMNQLGMGDAELLWVMSAFFLPHAAATLSFVFLRFTSRIAYSVMLISFAVTGVCLL
YVPFLAALFTVCITHACIGLALGFVFPLLLSHVVEISSARLKMSVMGFYQSFYALGIFLG
PLLAGKIAQLIGLAGVFYGAGSLAFAAFFVMLAQKRNMIN
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggaattacagcaggacttgattcctcagaaaaaaacaatcggcgctttagatcacgcc
gtttttttatgcatggtattttgtttctggttttcaggctatatttacgttcctgtattc
agtctgtatttggaggatctgcacttttcatatggcgcaatcggcatcattctcggcagc
tacggggtcacgcaaatccttctgcgattcccgctcggccttttgtcagacatcctgttt
tccttgcgcaagcaattgttaattgccgggttcggcttttccgtcctcagcagcctgctt
tttctgatgtttgattctttcttcttcgtgctggccgcccggcttttcgcgggaatcact
gcttctacgtgggtgatggcgaccattttatacgcacattatttcaacaatggcaatgca
tcaaaagcaatgggcatcatgcagttttttaccgtcatgcctcagtttgccagcattgtg
ttctgcgggctcgccgcagcccatttagggaggcaggttcctttttggatggcgctggca
gcttctgccgcaggtctggtgatctgctgctttattcaggatccgtctgctcctcccgca
aaccgtggcaccattcgtgtcaatcagtacatcaaagatacattgcggctgccaaagctg
aagcttttcaccatcctgtctatgacggcccatgccgtattatttatcacagtgtttggt
tttacgccgctttacatgaatcagctcggaatgggcgacgcggagctgctttgggtgatg
agcgcctttttcctcccacacgcagccgccacattaagctttgtgtttctgcgctttaca
agccgtatcgcttactccgtgatgctcattagtttcgctgtcaccggggtctgtttgcta
tatgttccttttttagctgcattgttcacggtttgcatcacacacgcctgtattgggctg
gcgctcggcttcgtttttcctctgctgctaagccatgtcgtcgaaatcagttctgcccgt
ttaaaaatgtcagtgatggggttttaccaatcattttatgcgctaggcatcttcctcggg
ccccttcttgccggaaaaatcgcacagcttatcgggcttgcgggagttttttatggagcc
ggttctctggcatttgccgccttttttgtgatgctcgcgcaaaaacgtaacatgatcaat
taa

DBGET integrated database retrieval system