KEGG   Bacillus subtilis subsp. subtilis 168: BSU38650
Entry
BSU38650          CDS       T00010                                 

Gene name
yxlG
Definition
(RefSeq) transmembrane protein YxlG
  KO
K01992  ABC-2 type transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38650 (yxlG)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU38650 (yxlG)
SSDB
Motif
Pfam: ABC2_membrane_2 ABC2_membrane_3 ABC2_membrane_5 ABC2_membrane_4 2TM
Other DBs
NCBI-GeneID: 937394
NCBI-ProteinID: NP_391744
Pasteur: BG12553
BSORF: BG12553
UniProt: P94375 A0A6M4JQK8
Position
complement(3967944..3968720)
AA seq 258 aa
MKVMMALLQKEWLEGWKSGKLIWLPIAMMIVGLTQPLTIYYMPEIIAHGGNLPDGMKISF
TMPSGSEVMVSTLSQFNTLGMALVIFSVMGSVANERNQGVTALIMSRPVTAAHYIVSKWL
IQSVIGIMSFAAGYGLAYYYVRLLFEDASFSRFAASLGLYALWVIFIVTAGLAGSTIFRS
VGAAAACGIGLTAAVSFAVSLFPDGAKWLPAEICKQAEHILLHGERADFFGWSLTFSILC
IMLLAVFSVWRFRRYESY
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaaggtgatgatggcgctattgcagaaggagtggctggaaggatggaaaagcggcaag
ctgatttggctgccgattgcgatgatgatcgtcgggctgacacagccgctgaccatttat
tatatgccggaaatcatcgcacatggagggaaccttcctgacggcatgaaaatcagtttt
acgatgccctccgggtctgaagtgatggtcagcacgctttctcaattcaacacgcttggc
atggctctggtcatctttagcgtgatgggcagtgtagccaatgaaagaaatcaaggggta
acagcgctgattatgtcgcggcctgtgacggcagcccattatatcgtgagtaaatggctc
atccaaagcgtgatcggcattatgtcgtttgcagctggatacgggcttgcttactattac
gtccggctgctgtttgaggacgcatcattcagccgctttgccgcaagccttggcctttac
gctctttgggtgatatttattgtgaccgccggccttgccggaagtacgatattccggtct
gtcggagcagctgcggcttgcgggatcgggctcacagcagccgtttcctttgctgtttca
ctatttccagatggtgcgaagtggcttccggctgagatttgcaagcaggcggagcatatc
cttcttcatggagagcgggcagattttttcggatggtcactcactttctccattctgtgc
atcatgcttctggccgtgttttctgtgtggcgcttccggcggtatgaaagctattaa

DBGET integrated database retrieval system