KEGG   Bacillus subtilis subsp. subtilis 168: BSU38660
Entry
BSU38660          CDS       T00010                                 

Symbol
yxlF
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38660 (yxlF)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU38660 (yxlF)
SSDB
Motif
Pfam: ABC_tran DUF4162 AAA_21 SMC_N AAA_13 AAA_29 AAA_23 AAA_22 SRP54 AAA_30 IstB_IS21 AAA_16 TsaE RsgA_GTPase AAA_27 AAA_33 AAA_19 AAA_15 AAA_28 AAA_24 AAA
Other DBs
NCBI-GeneID: 938137
NCBI-ProteinID: NP_391745
Pasteur: BG12552
BSORF: BG12552
UniProt: P94374 A0A6M4JQL9
Position
complement(3968717..3969604)
AA seq 295 aa
MLSIESLCKSYRHHEAVKNVSFHVNENECVALLGPNGAGKTTTLQMLAGLLSPTSGTIKL
LGEKKLDRRLIGYLPQYPAFYSWMTANEFLTFAGRLSGLSKRKCQEKIGEMLEFVGLHEA
AHKRIGGYSGGMKQRLGLAQALLHKPKFLILDEPVSALDPTGRFEVLDMMRELKKHMAVL
FSTHVLHDAEQVCDQVVIMKNGEISWKGELQELKQQQQTNVFTLSVKEKLEGWLEEKPYV
SAIVYKNPSQAVFELPDIHAGRSLLSDCIRKGLTVTRFEQKTESLEDVYLKVVHA
NT seq 888 nt   +upstreamnt  +downstreamnt
atgctgtctattgaatcattatgcaaatcgtacaggcaccatgaagctgtaaagaatgtc
agttttcacgtgaatgaaaatgagtgtgtcgcactattaggacctaatggagccggcaaa
accacgactctgcaaatgctggccggactgctttcgccaacctctggaaccataaagctg
ttaggagagaaaaagctggatcggcgtttgattgggtacctcccgcagtatcctgctttt
tattcgtggatgaccgcaaatgaatttttgacatttgcggggagactgtccggcctttcg
aagagaaaatgccaagagaaaatcggcgagatgctggaatttgtcggtttgcacgaagcg
gcgcacaaaaggatcgggggctattcaggaggcatgaaacaaagactcggtctggcacag
gcactgctccataaaccgaagtttttgatattggatgaaccggtgtctgcgcttgatccg
acaggacggttcgaggtgctggacatgatgcgggagctgaaaaagcatatggccgttctg
ttttctacacatgttttgcacgatgcagaacaggtgtgtgatcaagtggtgattatgaaa
aacggtgagatttcatggaaaggcgagttacaggagctgaaacaacagcagcaaacgaac
gtttttaccctttcagtgaaagagaagctggaaggttggcttgaagagaagccttacgtc
tcagctattgtctataagaatccgtcccaagcggttttcgagctgcctgatatacacgct
ggccggtcattattaagtgactgtatccgaaagggattgaccgtcacccgctttgaacag
aaaacggagtctctagaagacgtctatctaaaggtggtgcacgcatga

DBGET integrated database retrieval system