KEGG   Bacillus subtilis subsp. subtilis 168: BSU38670
Entry
BSU38670          CDS       T00010                                 

Symbol
yxlE
Name
(RefSeq) negative regulatory protein YxlE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PLDc_N DUF1772 Nucleos_tra2_N
Other DBs
NCBI-GeneID: 937395
NCBI-ProteinID: NP_391746
Pasteur: BG12551
BSORF: BG12551
UniProt: P94373 A0A6M3ZK98
Position
complement(3969611..3969799)
AA seq 62 aa
MNISWEMILPLIVLQLALAVFALISCIKEERTNGPKWMWAAIIVCINIIGPILFFTVGRK
QR
NT seq 189 nt   +upstreamnt  +downstreamnt
atgaatatttcttgggaaatgattttgccgctgattgtattacagctggctttggcggtg
tttgcccttatcagctgtataaaagaagagcggacgaacgggccaaagtggatgtgggct
gcaatcatcgtatgtatcaatattatcgggccgattttatttttcaccgtcggcagaaag
caaaggtaa

DBGET integrated database retrieval system