KEGG   Bacillus subtilis subsp. subtilis 168: BSU38680
Entry
BSU38680          CDS       T00010                                 

Symbol
yxlD
Name
(RefSeq) negative regulatory protein YxlD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2561 PepSY_TM_like_2 YajC
Other DBs
NCBI-GeneID: 937398
NCBI-ProteinID: NP_391747
Pasteur: BG12550
BSORF: BG12550
UniProt: P94372 A0A6M3ZI32
Position
complement(3969796..3970002)
AA seq 68 aa
MTQTEIIITVAACLIVLAQGIFLFIDAKKRNHMAWVWGIVGLIQAPMPLICYYFFVIRPD
RKKRGIKQ
NT seq 207 nt   +upstreamnt  +downstreamnt
atgacacaaacagaaattatcataacggttgcggcttgtctcatcgtattggcgcaggga
atctttttatttattgatgcgaaaaaacgtaatcacatggcatgggtttgggggattgtc
ggattgattcaagcaccgatgcctctgatttgttattacttttttgtcattaggccggat
cggaagaaaagggggatcaagcaatga

DBGET integrated database retrieval system