KEGG   Bacillus subtilis subsp. subtilis 168: BSU38690
Entry
BSU38690          CDS       T00010                                 

Symbol
yxlC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5345 Ac81 CCDC-167 DUF4191 MAP65_ASE1 Rho_Binding CrtO DUF2207
Other DBs
NCBI-GeneID: 938082
NCBI-ProteinID: NP_391748
Pasteur: BG12549
BSORF: BG12549
UniProt: P94371 A0A6M4JQL7
Position
complement(3969999..3970319)
AA seq 106 aa
MNKEKLSDHLKSEWKKIDQTANPSIPNQKELLHQLSQMKAEYRKKLLQEIILFVFCALMV
VSAAILAFTQAPAVFIVLQVCVLAVLPILIAAEKKRHLGECEVKRG
NT seq 321 nt   +upstreamnt  +downstreamnt
atgaataaagaaaagctttctgatcatttaaagtcagaatggaaaaaaattgatcaaaca
gccaatccctctataccgaatcaaaaagaactgcttcaccagctgtcacaaatgaaagct
gaatacagaaaaaaacttcttcaagagatcattttatttgtattctgcgcgctgatggtt
gtgagtgctgcaatcttagctttcactcaagctcctgctgtgtttattgtgcttcaggtt
tgtgtgcttgcggtgctgccgattttgattgcggctgagaaaaaaaggcatctcggcgaa
tgcgaggtgaaacgcggatga

DBGET integrated database retrieval system