KEGG   Bacillus subtilis subsp. subtilis 168: BSU38700
Entry
BSU38700          CDS       T00010                                 

Symbol
sigY
Name
(RefSeq) RNA polymerase sigma factor SigY
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU38700 (sigY)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU38700 (sigY)
SSDB
Motif
Pfam: Sigma70_r2 Sigma70_r4 Sigma70_r4_2 Sigma70_ECF HTH_16 APC1_C Terminase_5 GerE
Other DBs
NCBI-GeneID: 937400
NCBI-ProteinID: NP_391749
Pasteur: BG11975
BSORF: BG11975
UniProt: P94370 A0A6M3ZLN6
Position
complement(3970312..3970848)
AA seq 178 aa
MDTQEEQRLIQQAKEGNDEAFTALFHYHYSFLYKYLLKLSLHPDLSEELVQETFLKGYIH
LRSFQGRSKFSTWLISIASRLYLDHQKKRKREWKRNQTVTEETIRKIKWDVSAKGAEWSE
TLDLFSKLDPKLRTPVLLRHYYGYTYAEIGVMLQIKEGTVKSRVHKGLQQIRKEWDDE
NT seq 537 nt   +upstreamnt  +downstreamnt
ttggatacacaagaagaacagcggctgatccagcaggcgaaagagggaaacgacgaggcg
tttacagcccttttccactatcactattctttcttatataaatacttgttaaagctttcc
cttcaccccgatctcagcgaggaacttgttcaggaaacctttctgaaagggtacatccat
ttaagaagctttcagggccgttcaaaattctccacatggctgatctccattgcatcgcgg
ctctatctcgatcaccagaaaaagagaaagagagaatggaaacggaatcagacagttacg
gaggaaacaatccgcaagatcaagtgggacgtgtcggcgaaaggggcagagtggagcgaa
acgctcgatctgttttcaaagctggaccctaaactgcgcacaccggttttattaaggcat
tactacggctatacctacgctgaaatcggggtgatgcttcaaatcaaagaaggcactgta
aagtccagagttcataaagggctccagcaaatcagaaaggagtgggatgatgaataa

DBGET integrated database retrieval system