KEGG   Bacillus subtilis subsp. subtilis 168: BSU38720
Entry
BSU38720          CDS       T00010                                 

Gene name
yxkO
Definition
(RefSeq) ADP-dependent (S)-NAD(P)H-hydrate dehydratase
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU38720 (yxkO)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     BSU38720 (yxkO)
SSDB
Motif
Pfam: Carb_kinase HK Phos_pyr_kin
Other DBs
NCBI-GeneID: 937408
NCBI-ProteinID: NP_391751
Pasteur: BG12547
BSORF: BG12547
UniProt: P94368 A0A6M3ZHH4
Structure
PDB: 

Position
complement(3972448..3973278)
AA seq 276 aa
MNVPFWTEEHVRATLPERDAESHKGTYGTALLLAGSDDMPGAALLAGLGAMRSGLGKLVI
GTSENVIPLIVPVLPEATYWRDGWKKAADAQLEETYRAIAIGPGLPQTESVQQAVDHVLT
ADCPVILDAGALAKRTYPKREGPVILTPHPGEFFRMTGVPVNELQKKRAEYAKEWAAQLQ
TVIVLKGNQTVIAFPDGDCWLNPTGNGALAKGGTGDTLTGMILGMLCCHEDPKHAVLNAV
YLHGACAELWTDEHSAHTLLAHELSDILPRVWKRFE
NT seq 831 nt   +upstreamnt  +downstreamnt
atgaatgttccattttggacggaagagcatgtaagggccacgcttcctgaaagagatgcg
gagagccataaaggcacgtacggtacggctttgctgctggctggaagtgacgacatgccg
ggagcagcgctgcttgcagggcttggggccatgcggagcggtctcggcaagcttgtcatc
ggtacatcagaaaacgtaatcccgctaattgttcctgttttgcccgaggcgacctattgg
cgtgacggctggaaaaaggcggcggatgctcagcttgaagagacgtaccgggccattgcc
atcggaccgggccttccgcaaacggaaagcgtacagcaggcagtcgatcatgtgcttacg
gctgattgtcctgttattttggatgccggagcgctggcgaagcgcacatatccgaaacgg
gagggccccgtcatcctcacgccgcacccgggcgagtttttccgaatgacaggggtgccc
gtgaacgaattgcagaaaaaaagagcggaatatgcaaaggaatgggcggctcagctgcag
actgtcattgtgttaaaaggaaaccaaaccgtcatcgcgtttcctgatggagactgctgg
ctcaatccaaccggaaacggggcgctcgccaagggcggaaccggtgacacgctgacgggc
atgatattggggatgctctgctgccatgaagatccaaagcacgccgtattaaacgcggtc
tatttgcatggtgcgtgcgccgagctctggacggacgagcactccgctcatacgttgctc
gctcatgagctatctgacatcctgccccgcgtgtggaaacgatttgaatga

DBGET integrated database retrieval system