KEGG   Bacillus subtilis subsp. subtilis 168: BSU38730
Entry
BSU38730          CDS       T00010                                 

Gene name
cydD
Definition
(RefSeq) ATP-binding/permease protein CydD
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU38730 (cydD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38730 (cydD)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BSU38730 (cydD)
SSDB
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_29 SMC_N AAA_16 RsgA_GTPase
Other DBs
NCBI-GeneID: 936330
NCBI-ProteinID: NP_391752
Pasteur: BG11928
BSORF: BG11928
UniProt: P94367 A0A6M3ZHU6
Position
complement(3973364..3975091)
AA seq 575 aa
MKKEEWILPYIKQNARLFVLVIFLGAVTIFSAAFLMFTSGFLISKAATRPENILLIYVPI
VAVRTFGIARSVSRYVERLVGHHIILKIVSDMRVRLYNMLEPGALMLRSRFRTGDMLGIL
SEDIEHLQDAFLKTIFPAISALLLYAVSVIALGFFSWPFAILLALYLFVLVVLFPVVSLL
VTRAKNAKLKSGRNVLYSRLTDAVMGVSDWMFSGRRHAFIDAYEKEERDWFELERKKQRF
TRWRDFAAQCLVAGLILLMLFWTAGQQADGELAKTMIAAFVLVVFPLTEAFLPLSDALGE
VPGYQDSIRRMNNVAPQPEASQTESGDQILDLQDVTLAFRDVTFSYDNSSQVLHNFSFTL
RQGEKMALLGRSGSGKSTSLALIEGALKPDSGSVTLNGVETALLKDQIADAVAVLNQKPH
LFDTSILNNIRLGNGEASDEDVRRAAKQVKLHDYIESLPDGYHTSVQETGIRFSGGERQR
IALARILLQDTPIIILDEPTVGLDPITERELMETVFEVLKGKTILWITHHLAGVEAADKI
VFLENGKTEMEGTHEELLAANERYRRLYHLDVPVK
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgaagaaagaagaatggattttgccgtatatcaagcaaaatgcccgcctgttcgttctg
gttatctttttgggtgcggtgacgattttttctgctgcttttctcatgttcacctcaggt
tttttgatttctaaagcggcgacaaggccggaaaacattctgctcatttatgtgccgatt
gtcgctgtgcgcacctttgggattgcgcgctctgtgtcgcgatatgtggaacggctcgtc
ggccatcacatcattttgaaaatcgtatctgacatgcgcgtccgcctttacaatatgctt
gagccgggtgctttgatgctgcgttcccgttttcgcacgggggatatgctcggcattttg
tctgaggatattgagcatttgcaggatgctttcttaaaaacgatttttcctgcgatctca
gccttgctcctgtatgctgtgtcagtgatagcgctcggcttcttctcttggccgtttgcc
atattgcttgcgctgtatttgtttgttcttgttgtattgtttccggttgtgtctttgctc
gtgacgagagcgaagaatgcgaagctgaaaagcggacggaatgtgctgtacagccgtctg
acagatgctgtgatgggtgtcagcgactggatgttcagcggacgccggcatgcttttatt
gatgcttatgaaaaagaggaacgtgattggtttgagcttgaacggaaaaaacaacgcttt
acaagatggcgggactttgctgcgcaatgccttgtcgctggccttattttgctgatgctg
ttttggacagcgggacagcaagcggacggcgagctcgctaaaacgatgattgccgctttt
gtgctagtggtgtttccgttgacggaagcctttttgccgctttcggatgccttaggcgaa
gtgccgggctatcaggattctatcagacgcatgaacaatgtggctcctcagccggaggcg
tcacaaactgaatcaggggatcaaattctcgatcttcaagatgtcaccttggcctttcgt
gatgtgacgttttcttatgacaacagcagccaagtgctgcacaacttttcctttacgctg
cgccaaggagaaaaaatggcgctgctcggccgaagcggctctgggaaatcaacatcgctt
gcattaatcgaaggcgccttgaaaccggactccggttctgtgacgttaaacggagtggag
acagcgctgttaaaggatcagattgcggatgcggtggccgtgttaaatcaaaaaccgcac
ctgtttgatacaagcattttgaacaacatcaggctcggaaacggagaagcaagcgacgag
gatgtgcgccgcgccgcaaagcaggtcaagctgcatgactacattgagtcattgcctgac
ggatatcatacctctgtacaagaaaccggcatccgtttttccggtggagagcgccagcgg
atcgcacttgcgaggattttgctgcaggatacaccgatcatcatcctcgatgagccaaca
gtcggcctcgatcctattaccgaacgtgaattgatggaaacggtgtttgaggtgctgaaa
ggaaaaacgattttatggattacacaccatctcgcgggagtggaagcagccgataaaatc
gtatttctcgaaaacggcaaaacagaaatggaaggaacccatgaggagctgctggcggca
aacgaacgatatcgccgcctgtatcaccttgatgttcctgtaaaataa

DBGET integrated database retrieval system