KEGG   Bacillus subtilis subsp. subtilis 168: BSU38740
Entry
BSU38740          CDS       T00010                                 

Symbol
cydC
Name
(RefSeq) ATP-binding/permease protein CydC
  KO
K16013  ATP-binding cassette, subfamily C, bacterial CydD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU38740 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38740 (cydC)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BSU38740 (cydC)
SSDB
Motif
Pfam: ABC_tran ABC_membrane AAA_21 MscS_TM AAA_29 SMC_N RsgA_GTPase MeaB AAA_23 MMR_HSR1 Zeta_toxin
Other DBs
NCBI-GeneID: 936498
NCBI-ProteinID: NP_391753
Pasteur: BG11927
BSORF: BG11927
UniProt: P94366 A0A6M3ZHX5
Position
complement(3975088..3976791)
AA seq 567 aa
MGKDLFRYKGMKRILTLITCLTLIQTAAIIMQAEWLSEAVTGLFNGKGITSLLPVIGFFL
IAFIARHGMTVARQKIVYQYAARTGADLRKSFLDQLFRLGPRFAKKEGTGQMVTLAMEGI
SQFRRYLELFLPKMVSMAIVPAAVVIYVFFQDRTSAIILVAAMPILIIFMILLGLVAQRK
ADRQWKSYQRLSNHFVDSLRGLETLRFLGLSKSHSKNIFYVSERYRKATMSTLRVAFLSS
FALDFFTMLSVATVAVFLGLRLIDGDILLGPALTALILAPEYFLPVREVGNDYHATLNGQ
EAGKTIQEILSQPGFKEETPLQLEAWSDQDELKLSGVSVGRSVSDIHLSFKGKKKIGIIG
ASGAGKSTLIDILGGFLEPDGGMIEVNGTSRSHLQDGSWQKNLLYIPQHPYIFDDTLGNN
IRFYHPSASAEDTTRAAASAGLTELVNNLPDGLEGRIGEGGRALSGGQAQRVALARAFLG
NRPILLLDEPTAHLDIETEYEIKETMLDLFEDKLVFLATHRLHWMLDMDEIIVLDGGRVA
EIGTHNELLEKNGVYTKLVKAQLGERA
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggaaaagacctgtttcgatataaaggaatgaagcggattctcaccttgattacttgt
ttaacgttgattcagacagccgccattattatgcaggcagagtggctgagtgaggccgta
accggactgttcaacgggaagggcattacctcccttttaccggtgatcggctttttcctc
atcgcttttatcgcccggcacgggatgacggtggcgcgacagaaaatcgtctatcaatac
gccgcccggacaggagcagatttgaggaaaagttttcttgatcagctgttccgattaggc
ccccgctttgcaaagaaagaggggacggggcaaatggtgacgctggcgatggaaggcatc
agccagttccgccgctacctggagctgtttctgccgaaaatggtcagcatggcgattgtg
cctgcggcagttgtcatttatgtgttttttcaggatcggacatcagccatcattttagtc
gctgctatgccgattctgatcatctttatgattctcctcggccttgtcgcgcagagaaaa
gcggatcgtcagtggaaatcctatcagagactttccaatcattttgttgattctcttcgc
gggctggagacattgcgtttcctaggtttgagcaagtcacacagcaaaaatattttctat
gtgagtgagcggtatcgcaaggcaacgatgagcacactccgggtggcgtttttgtcatca
ttcgccctcgattttttcacgatgctgtcggtggcgacagtcgcagtatttctgggcctg
cgcctcattgacggcgatattttgcttggccctgctttaacggcgcttattctggcgcct
gagtattttttgccggtgcgggaagtggggaatgattatcatgcaacgctgaacggccag
gaagcaggaaaaaccattcaagagattttgtcgcagcctggttttaaagaagagacgccg
cttcagctcgaagcttggtccgatcaggatgagctgaagctgtcaggcgtgtcagtcggc
cgttcggtgtctgatattcatctctcattcaaaggcaagaaaaaaatcggcattatcggt
gcaagcggcgccggaaaatcaacattaattgatattctcggcggatttttagagccggat
ggcgggatgattgaggttaatggtacaagccggtcccatttgcaggacggcagctggcag
aagaaccttctttacattccccagcatccgtacatttttgatgatacgcttggcaacaac
attcgcttctaccatccaagcgcttcggcagaggatacaacacgtgctgctgcctcagcg
ggactgacggagctggtgaacaaccttcctgacggattagaggggcggatcggggaaggc
ggccgggcgctcagcggcggccaggcacagcgtgtcgcgctggcccgcgcctttttggga
aaccgtccgatcctgctgctggatgagccgaccgcccatcttgatatcgaaacagaatat
gaaataaaagaaacgatgctggatttatttgaggataagctcgtctttctcgcgactcac
cgccttcactggatgctcgatatggacgaaattatcgtgcttgacgggggcagggttgcg
gaaattgggactcacaatgaactgctggagaaaaacggtgtgtataccaaactcgtgaag
gcacaactgggggaaagagcatga

DBGET integrated database retrieval system