KEGG   Bacillus subtilis subsp. subtilis 168: BSU38750
Entry
BSU38750          CDS       T00010                                 

Symbol
cydB
Name
(RefSeq) cytochrome d ubiquinol oxidase subunit 2
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:7.1.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU38750 (cydB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU38750 (cydB)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)
     BSU38750 (cydB)
SSDB
Motif
Pfam: Cyt_bd_oxida_II YjcB
Other DBs
NCBI-GeneID: 937412
NCBI-ProteinID: NP_391754
Pasteur: BG11926
BSORF: BG11926
UniProt: P94365 A0A6M4JQL6
Position
complement(3976791..3977807)
AA seq 338 aa
MASLHDLWFILVAVLFVGFFFLEGFDFGVGMATRFLGHNELERRVLINTIGPFWDANEVW
LLTGAGAIFAAFPNWYATMLSGYYIPFVIVLLALMGRGVAFEFRGKVDHLKWVKVWDWVV
FFGSLIPPFVLGVLFTTLFRGMPIDADMNIHAHVSDYINVYSILGGVTVTLLCFQHGLMF
ITLRTIGDLQNRARKMAQKIMGVVFVAVLAFAALSAYQTDMFTRRGEITIPLAVLIVICF
MLAAVFIRKKKDGWTFGMTGAGLALTVGMIFISLFPRVMVSSLHSAYDLTVANASSGDYS
LKVMSIAALTLLPFVIGSQIWSYYVFRKRVSHKEPMTY
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggcatctcttcatgatctttggtttatactcgttgctgtattgtttgtaggattcttc
tttttggaaggctttgatttcggggtcggcatggcgacccgttttcttggccataatgaa
ttagaacgcagagtgctgatcaacacgatcgggccgttctgggacgcgaatgaagtgtgg
cttttgactggcgcaggcgccattttcgcggcattcccaaactggtatgcaacgatgctg
agcggttattacattccgtttgtcatagtgctgcttgcgttaatgggccgcggggtcgcg
tttgagttccgcggcaaggtggatcatttaaaatgggtaaaggtttgggactgggtcgtt
tttttcggcagtctaattcctccgtttgtgcttggtgtgctgttcacgacattattccgc
gggatgccgattgatgccgacatgaacattcacgcacatgtatctgattatatcaatgta
tattctatacttggcggtgtgacggtaacgcttctttgcttccagcatggattaatgttt
atcacgctgcgtacgattggtgatttgcaaaaccgcgcccggaaaatggcgcaaaagata
atgggtgttgtttttgtagcggttcttgccttcgcggccctttctgcgtatcagacagac
atgtttacacgccgcggcgagattaccattccgctcgctgttttgattgtcatctgcttt
atgctcgcggctgtatttattcgtaagaaaaaagacggctggacatttgggatgacaggc
gctggtctggcgctgaccgtgggaatgatctttatttccctattccctcgtgtaatggtc
agctcgcttcatagcgcatacgatttaacagtagctaacgcttcttctggagattattcg
cttaaagtcatgtcaattgcagcattaacgctattgccgttcgtcatcggcagccagatc
tggagctattatgtcttccggaagcgcgtcagccataaggagcctatgacttattaa

DBGET integrated database retrieval system