KEGG   Bacillus subtilis subsp. subtilis 168: BSU38770
Entry
BSU38770          CDS       T00010                                 

Symbol
cimH
Name
(RefSeq) citrate/malate transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: 2HCT
Other DBs
NCBI-GeneID: 937407
NCBI-ProteinID: NP_391756
Pasteur: BG12546
BSORF: BG12546
UniProt: P94363 A0A6M3ZHQ2
Position
3979753..3981105
AA seq 450 aa
MGELQTHMQLQTDTIHEGVRKENWFAKAMNIKVGIIPLPVYALLFILITVFVMHHDVKSD
ILTSIAVMAFFGFTFAQIGKSIPIVRSIGGPAILATFIPSAVVYYHLLPNDIVKSTTEFT
ENSNFLYLFIAGIVVGSILGMKRETLVKAFMKIFIPLIVGSVTAAIVGLAVGTLLGLGFQ
HTLLYIVIPIMAGGVGEGAIPLSIGYSDIMPISQGEAFALVLPSIMLGSLCAIILAGLLN
RIGKKKPEWTGNGKVDRSEEESPALEESQSGQQMFNLSLFASGGILAVSLYLVGMLAHDF
FGFPAPVAMLLLAVLIKLFRLVPASIENGAFGVSRFFSTAVTYPLLFAIGVSMTPWDKLV
AAFNLSNIITILSVVVTMMAVGFFTGKWLNMYPIETAIINACHSGQGGTGDVAILSAAER
LELMPFAQVSTRIGGAITVSLTLLLLHQFY
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgggagagcttcaaacacacatgcaattgcaaacggatacaattcacgaaggggttcga
aaagagaattggtttgcgaaagccatgaatataaaagtaggcatcataccgcttcctgtg
tatgccttgctgtttatattaatcactgtttttgttatgcatcacgatgtaaaaagtgac
attttgacatccattgccgtcatggcgtttttcgggtttacctttgcccaaatcggcaaa
tcgataccgattgttcgttctatcggcggcccggccatcctagctacttttattccgtcc
gctgtcgtgtactatcacctgctgcctaatgatatcgtcaaatccaccacagaatttaca
gaaaactcaaactttctatatttgtttatcgccggtattgtcgtcggaagcattctcggc
atgaaaagagaaacactcgtaaaagcattcatgaaaatctttattccgcttattgtcggt
tctgtcacagccgctattgtcggactggctgtcgggacattgctcggactcggatttcag
cataccctgctgtacattgtcattccgatcatggctggaggagtcggagaaggcgctatc
ccgctgtccatcggatattctgacatcatgcccatttctcaaggggaagcgtttgcactt
gttctgccatcgattatgctgggcagcttgtgcgcgattattctagcgggattgctgaac
cgaatcggaaagaaaaaaccggaatggacaggcaacggcaaagtggaccgctccgaagaa
gagtcccctgcgctggaggaatctcaaagcggacagcaaatgttcaacctttctttattt
gcgtcaggcggtatccttgctgtttctttatacttagtcggcatgctcgctcacgatttt
ttcggttttccggcacccgttgccatgctgttactggctgttctaatcaagctgttcaga
ttggtgcctgcctcaattgaaaatggcgcgtttggagtgtcccgcttcttttcaacagct
gtgacctacccgcttctctttgcgattggggtatccatgacgccgtgggacaagcttgtc
gccgcttttaacctcagcaatattatcacgattctgtctgtcgttgtgaccatgatggcc
gttggcttcttcactggaaaatggctgaacatgtatccgattgaaaccgccattattaat
gcatgccattctgggcaaggcggcacgggtgacgttgccattttaagcgccgctgaaagg
cttgagctaatgcctttcgcccaggtgtctacccgcatcgggggcgcgattacagtatcc
ttaaccttattgctgctgcaccagttttattga

DBGET integrated database retrieval system