KEGG   Bacillus subtilis subsp. subtilis 168: BSU38780
Entry
BSU38780          CDS       T00010                                 

Symbol
yxkI
Name
(RefSeq) membrane metalloprotease YxkI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M56
Other DBs
NCBI-GeneID: 937415
NCBI-ProteinID: NP_391757
Pasteur: BG12545
BSORF: BG12545
UniProt: P94362 A0A6M3ZKA6
Position
3981227..3982915
AA seq 562 aa
MPMGTHLFLFMLLGLGFYLISALAAKLIPAIDFWIDIVLWVGAAAYIFSHLSFMDGIVSL
ATMFYCYWTAMDLIVSERVEKPSGDWQEIELAKNKTRLLSDITLTAIVFAGAVIFFIYGP
DTSPLKYVILLGMISGGGALVKRILNVFSVKVFYSAALEKLHISSHYETRTYPLSDLKNI
QLESTADLLKLHPLLTMYSSRLDLTTSFQQVIKLSLPGETLFLTVKEPQKWKTILQEYTD
AENNVDNVISVLPFYHRKNVKRLLGKLYFAASVKGVSAYALLVLALYALHASPWVMAVAV
ILYWVFNMYMSDRVLRAAMDAKSCHHPHVQAAADKIFRSAGISHVRIYETESDDYNGMAV
GMNVGRSMVILTSATLTLPQRVIEGILAHEAIHIKKRDVLSSQLLRFLYLGAVVGIFLLF
EQHITHPEAHKIALWAFIMAIIILFQLYQSFCSQWMEVRADNLGASLLDGGYKQMAEALR
ILAVRQDEDIQKQSAYSSEAGEDELQIDSLTRDKSWFFRLIDFQFAPHPPMYWRVGTLLS
NKGHGVLKRWLRDRLKESITLK
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgcctatgggaactcatctatttctctttatgcttctcgggctgggattttatttgata
tcagccctagctgcaaaactcattccggccatagacttctggattgatattgttctatgg
gtcggcgctgcggcttacatcttctctcatctctcattcatggacggcattgtctcactc
gcgacaatgttctactgctattggaccgcaatggatctcattgtttcagagcgtgtggaa
aaaccttcgggagactggcaggaaatcgagcttgccaaaaacaaaacacgcctcctgtca
gacattacgctgaccgccattgtgtttgcaggggctgtcatttttttcatctatggacct
gacacaagccctctcaaatatgtgatccttctcggaatgatctccggcggaggggcactt
gtgaagcgaatactgaatgtttttagcgtaaaggttttttattcagcagccttagaaaaa
ttgcatatcagctcacactatgaaacccgtacatacccgctttccgatttgaagaacatt
cagcttgaatcaacagcagatctcttaaagctccatccgcttctgacgatgtattcatcc
cgtttagatttgacaacaagctttcagcaagtcattaaactgtctcttcccggcgaaaca
ctgtttctgacggtgaaggaaccgcaaaaatggaaaacaattcttcaggaatacacagat
gcagaaaacaatgtggacaatgtgatttctgttttgccgttttatcatcgaaaaaatgtg
aagcggctgctcggtaagctttattttgccgccagcgtaaaaggggtatccgcttacgcc
ttattggtgctcgcgttatacgcattacacgcctctccatgggtcatggctgttgccgta
atcctatattgggtattcaacatgtatatgtcagaccgtgtgttgcgggcggcgatggac
gccaagtcttgtcatcatccgcatgtacaggccgcggccgataagattttcagatcggcc
ggcatttcccatgtccgcatatacgaaacggagagtgatgattacaacggaatggcagta
ggcatgaatgtcgggaggtcaatggtcatcctgacaagcgccacactaacacttccacag
cgtgtcattgaaggcattctggcccatgaggcgattcatatcaaaaaacgtgacgttctg
tcatcacagcttttgcgttttctatatcttggagctgtcgtggggattttcctcttgttt
gagcagcatatcacccatcccgaggcccacaaaattgcgctttgggctttcattatggca
atcattatcctattccagctctatcaatccttttgttcacaatggatggaggtgcgtgct
gacaaccttggcgcatcattgctggacggcggttacaaacaaatggctgaagccttgaga
atcttggcggttcggcaagatgaggatatacagaaacaaagtgcctatagctctgaagca
ggtgaagacgagcttcaaattgattctctcacccgtgataaaagctggtttttcagattg
attgattttcagttcgctcctcatcctcctatgtattggcgtgtcggcactttattgtca
aacaaaggacatggggtgctaaagcgctggctcagagaccgactgaaagaatcgatcact
ttgaaatga

DBGET integrated database retrieval system