KEGG   Bacillus subtilis subsp. subtilis 168: BSU38790
Entry
BSU38790          CDS       T00010                                 

Gene name
yxzE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GRP DUF5706 YajC
Other DBs
NCBI-GeneID: 937409
NCBI-ProteinID: NP_391758
Pasteur: BG14168
BSORF: BG14168
UniProt: O32284 A0A6M3ZI43
Position
3982973..3983173
AA seq 66 aa
MIVIILLFISIIVFLSVIQPQPSKNKSRQQADSGYFGYSDHSSHHDGCSSDGGFSDSGCG
GGGGGD
NT seq 201 nt   +upstreamnt  +downstreamnt
gtgattgtgatcatcttattgtttatatctattattgtttttctttcagtcattcagccg
cagccctcgaaaaacaaaagccgccagcaggcggacagcgggtatttcggttattcagat
catagctcacaccatgatggatgcagcagtgacggaggtttcagcgattccggctgtggc
ggcggagggggcggcgattaa

DBGET integrated database retrieval system