KEGG   Bacillus subtilis subsp. subtilis 168: BSU38800
Entry
BSU38800          CDS       T00010                                 

Symbol
yxkH
Name
(RefSeq) polysaccharide deacetylase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Polysacc_deac_1 DUF6034 DIM
Other DBs
NCBI-GeneID: 937411
NCBI-ProteinID: NP_391759
Pasteur: BG12544
BSORF: BG12544
UniProt: P94361 A0A6M3ZLP2
Position
complement(3983187..3984026)
AA seq 279 aa
MKRLFLSIFLLGSCLALAACADQEANAEQPMPKAEQKKPEKKAVQVQKKEDDTSAWIKTE
KPAKLPILMYHSISSGNSLRVPKKEFEAHMKWLHDNGYQTLTPKEASLMLTQDKKPSEKC
VLITFDDGYTDNYQDAYPVLKKYGMKATIFMIGKSIGHKHHLTEEQMKEMAQHGISIESH
TIDHLELNGLTPQQQQSEMADSKKLFDNMFHQQTTIISYPVGRYNEETLKAAEKTGYQMG
VTTEPGAASRDQGMYALHRVRVSPGMSGSAFGAYIESMK
NT seq 840 nt   +upstreamnt  +downstreamnt
atgaaacgattgtttttaagcatctttcttttgggcagctgtttggctcttgcggcttgt
gctgatcaagaggcgaatgcagagcagccgatgccaaaagcggaacaaaagaaaccggaa
aaaaaggcagtacaagttcagaaaaaagaagacgatacatccgcatggatcaaaacagag
aaaccggcaaagctgccgattttgatgtaccacagcatttcttcaggaaacagcctccgt
gtgccaaagaaagaattcgaggcgcatatgaagtggcttcatgataacggctatcagaca
ttaacgccgaaagaggcatctctcatgctgacgcaggataaaaaaccgagtgagaagtgc
gtgctgatcacatttgatgacgggtacaccgacaattatcaagatgcgtatccggtgctg
aaaaagtacgggatgaaggcaacgatttttatgatcggcaaatcgatcggacataagcac
catctgacagaggaacaaatgaaggaaatggcacagcacggcatatcgattgaaagccat
acgattgaccaccttgagctgaacggattaacgcctcaacagcagcaaagtgagatggct
gattcgaaaaagctgttcgacaacatgtttcatcagcaaaccaccatcatcagctatccg
gtagggcgctacaatgaggagacgctgaaggccgctgaaaaaacaggctatcaaatgggc
gtgacgacagaaccgggcgcggcttcgagagaccagggaatgtatgccctccatcgtgtg
cgcgtgtccccaggcatgtcaggctcggcttttggtgcgtacatcgaatcaatgaaataa

DBGET integrated database retrieval system