KEGG   Bacillus subtilis subsp. subtilis 168: BSU38810
Entry
BSU38810          CDS       T00010                                 

Symbol
msmX
Name
(RefSeq) maltodextrin import ATP-binding protein MsmX
  KO
K10112  multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU38810 (msmX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38810 (msmX)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    BSU38810 (msmX)
   Maltose transporter
    BSU38810 (msmX)
   Arabinogalactan oligomer/maltooligosaccharide transport system
    BSU38810 (msmX)
   Raffinose/stachyose/melibiose transporter
    BSU38810 (msmX)
   Alpha-glucoside transporter
    BSU38810 (msmX)
   Glucose/mannose transporter
    BSU38810 (msmX)
   Trehalose/maltose transporter
    BSU38810 (msmX)
   Cellobiose transporter
    BSU38810 (msmX)
   N,N'-Diacetylchitobiose transporter
    BSU38810 (msmX)
   L-Arabinose/D-xylose transporter
    BSU38810 (msmX)
   Putative fructooligosaccharide transporter
    BSU38810 (msmX)
   Putative sorbitol/mannitol transporter
    BSU38810 (msmX)
   Arabinooligosaccharide transporter
    BSU38810 (msmX)
   Putative multiple sugar transporter
    BSU38810 (msmX)
SSDB
Motif
Pfam: ABC_tran OB_MalK CysA_C_terminal TOBE_2 SMC_N TOBE Rad17 AAA_21 AAA_22 RsgA_GTPase AAA_16 AAA_18 AAA_23 AAA_33 AAA RNA_helicase PmrD AAA_28 AAA_30 AAA_29
Other DBs
NCBI-GeneID: 937422
NCBI-ProteinID: NP_391760
Pasteur: BG11954
BSORF: BG11954
UniProt: P94360 A0A6M3ZIK7
Position
complement(3984133..3985230)
AA seq 365 aa
MAELRMEHIYKFYDQKEPAVDDFNLHIADKEFIVFVGPSGCGKSTTLRMVAGLEEISKGD
FYIEGKRVNDVAPKDRDIAMVFQNYALYPHMTVYDNIAFGLKLRKMPKPEIKKRVEEAAK
ILGLEEYLHRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRAEIIKL
HQRLQTTTIYVTHDQTEALTMATRIVVMKDGKIQQIGTPKDVYEFPENVFVGGFIGSPAM
NFFKGKLTDGLIKIGSAALTVPEGKMKVLREKGYIGKEVIFGIRPEDIHDELIVVESYKN
SSIKAKINVAELLGSEIMIYSQIDNQDFIARIDARLDIQSGDELTVAFDMNKGHFFDSET
EVRIR
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggctgaattgcggatggagcacatttataaattttatgatcagaaggaaccggcggtt
gatgactttaaccttcatattgccgataaggaatttatcgtattcgtcggcccgtccggc
tgcgggaaatcaacgacgctgcgaatggtcgcaggacttgaagaaatttcgaaaggtgat
ttttatattgaaggaaaacgggtcaatgatgtagcgccaaaggacagggatatcgcgatg
gtatttcagaactacgcgctttatccgcatatgacggtctacgataatatcgcgttcggg
ctcaagcttcggaaaatgccgaagcctgaaatcaaaaaaagagtcgaagaagccgctaaa
attctcgggcttgaggaatatttgcaccgtaaaccgaaagcgctgtcaggcggacagaga
cagcgggttgcgctgggccgggcaatcgtgcgggatgcaaaggtgttcctgatggatgag
cctttgtcaaacctggacgcgaagctgagggtgcaaatgcgggcggaaatcattaagctc
caccagagattgcagactacaacgatttatgtgacgcatgaccagacagaagcgctgaca
atggcgacacggattgtagtcatgaaagatgggaaaattcagcagatcgggacgccgaag
gatgtatatgaattccctgaaaacgtctttgtcggcgggtttatcggatcaccggcgatg
aattttttcaaaggaaagctcacggatggcttaatcaaaatcggttctgcggcattaacc
gtcccggaaggaaaaatgaaagtgctgcgtgaaaaaggctacatcggcaaagaggtcatc
ttcggcatccgtcctgaggatatacatgatgaattgattgtcgtggaatcatataagaac
tcttcgattaaggcgaaaattaatgttgcagagctgctcggttctgaaattatgatttat
tcgcagatagacaaccaagactttattgcgcggatcgacgcccgcctcgatattcaatcg
ggcgatgagctgacggttgcatttgatatgaataaaggccatttctttgacagtgagaca
gaagtgagaatccgataa

DBGET integrated database retrieval system