KEGG   Bacillus subtilis subsp. subtilis 168: BSU38820
Entry
BSU38820          CDS       T00010                                 

Symbol
yxkF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_30 HTH_8
Other DBs
NCBI-GeneID: 937413
NCBI-ProteinID: NP_391761
Pasteur: BG12543
BSORF: BG12543
UniProt: P94359 A0A6M3ZHI4
Position
complement(3985351..3986244)
AA seq 297 aa
MKSLLAIYPGSIVSEELCIREGCLCFFDESNQRYISIPKTEISEKEVLVLQSFLTPADEG
NQLSMKSPEENKWFSFLFSRGELPAYIKKRTRFVHFHLFGKIERTSFTEAVRHFWPVSFV
IVWIHEDRGVIVEQESEAAAEKDELESLAKVLESDFYFSVRFYAGRFYEPDECLRKHYAR
EQAYFLFAEKRLPQVQSVTFEMIFPFLLLETEKEKLETLLSEEAELLFGSESELRKTIKL
FIENNSNVTLTAKKLHLHRNSLQYRIDKFIERSGIDIKSYKGALLAYFICLQNESSE
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaaatcgctgctggctatttatcccggttcgattgtgtctgaggagctttgcataagg
gaaggctgtctatgtttttttgatgagagcaatcagagatatatctccattccgaaaaca
gagatcagtgaaaaagaagtattggtgctgcagtcatttttgacgcctgcggatgagggc
aatcaactgtctatgaaatcacctgaggaaaacaagtggttttcgttccttttttccaga
ggggaattgccggcgtatataaagaaacggacgagatttgttcactttcatttattcggc
aaaatagaaaggacgtcctttacggaagcggttcgccatttttggccggtgtcttttgtg
attgtgtggatccatgaggacagaggtgtgattgtcgagcaggaaagtgaagcggcggcg
gagaaggacgaactggaatcgctcgctaaggttcttgaaagtgatttctacttcagtgtc
cgtttttacgccggaagattttacgagccggatgagtgtctgcgaaaacattacgctcgt
gaacaggcgtatttcctgtttgctgaaaaacggctgcctcaggtgcagagtgtgaccttt
gagatgatctttccttttctattattagaaacagaaaaagaaaaactggaaacactgctc
tctgaagaagctgagcttttatttggaagtgaatctgagctaaggaagaccattaagctg
tttattgaaaacaactcaaacgtcacattaacagcgaaaaagctgcatctgcatcgcaac
agcctgcaatatcggattgataaatttattgagcggtcagggatagatatcaaatcgtac
aaaggcgcgcttcttgcctattttatctgcctgcaaaatgaaagttcagaataa

DBGET integrated database retrieval system