KEGG   Bacillus subtilis subsp. subtilis 168: BSU38840
Entry
BSU38840          CDS       T00010                                 

Gene name
yxkD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YitT_membrane DUF2179
Other DBs
NCBI-GeneID: 937425
NCBI-ProteinID: NP_391763
Pasteur: BG12542
BSORF: BG12542
UniProt: P94357 A0A6M3ZHY7
Position
complement(3987927..3988763)
AA seq 278 aa
MKKRMLDVLMLVIGAFFFALAVNLFAIPNDLGEGGVTGITLILYYLFQWSPGVTNFILNA
FLLLIGYKFLDGKTTVYTIIAVAANSLFLHLTHGWSIPSDELIINTIFAGVFAGVGIGMI
IRVGGTTAGSAILARIANKYLDWNISYALLFFDLIVVFSSYFIIGAEKMMFTIVMLYIGT
KVMDFIIEGLNTKKAITVISENKSEIAEQVNTLMDRGVTILSGKGNYTGQSKEILYIVIN
KQELSMLKKIIRSCDKKAFVIVHDVRDVFGEGFVDISK
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaaaaagagaatgctggatgtacttatgcttgtgattggcgcttttttcttcgcgctt
gcggttaatttatttgcgattcccaatgatcttggggaaggcggagtcactgggattacg
ctgattttgtattatctgtttcaatggtctcctggtgtcacgaactttatcttaaatgcg
tttttgcttttaatcggctacaagtttcttgatggaaaaacaacggtttatacgatcatt
gcggttgcggcaaattcgctttttcttcatctgacacatgggtggagcattccgtctgat
gaattgatcattaatacgattttcgcaggtgtatttgccggagtcgggatcggcatgatt
atccgggtcggcgggacgacggccggttccgcgattctggccagaattgctaataaatat
ttagactggaatatcagctatgcactcttgttttttgatttaatcgtagtatttagctct
tattttattattggtgcagaaaaaatgatgtttacgatcgtgatgctgtatatcggtacc
aaagtgatggacttcattattgaaggtttgaatacgaaaaaagccattacggtcatttca
gaaaataagagtgagattgcagagcaggtaaataccttgatggatcggggcgtgacgatt
ttatcagggaagggaaattatacgggccagtcaaaagagattttgtatatcgtcattaac
aaacaggagctgtctatgctgaaaaaaatcattagaagctgcgacaaaaaagcgtttgtg
atcgtacatgacgtacgcgatgtgtttggcgaagggtttgtggatatatctaaataa

DBGET integrated database retrieval system