KEGG   Bacillus subtilis subsp. subtilis 168: BSU38850
Entry
BSU38850          CDS       T00010                                 

Symbol
yxkC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4352 DUF5067 zf-ribbon_3 zinc_ribbon_2 zf-C3HC4_3 DZR zf-tcix HVO_2753_ZBP DUF4232 HypA zinc_ribbon_15 Zn_Tnp_IS1595 Prok-RING_1
Other DBs
NCBI-GeneID: 937416
NCBI-ProteinID: NP_391764
Pasteur: BG12541
BSORF: BG12541
UniProt: P94356 A0A6M3ZMC0
Position
3989232..3989873
AA seq 213 aa
MAGKLVPCKACGQEIAKGVKKCPNCGKDQRNFFMRHKIITFILAVVVIIIIGNMIGGGGG
SEATSKTSSSSKAETEKTYNIGDTVKTEKTEVTVTKVEDRDTVGTQYVEKKASEGGTIVA
VQYTIKNVSKKPISSFSIPTVKLVDADGTSYDSDIDASVNYATETKVDNSKILSDLNPNI
KVTGVKAFEVDKEAYAKGTWKLKFSNDVIVKIK
NT seq 642 nt   +upstreamnt  +downstreamnt
atggcaggaaaactagtaccctgtaaagcttgcggtcaagaaattgcaaagggtgtaaaa
aaatgtcctaactgcggtaaggatcaacgtaacttttttatgcgacataaaatcattacg
tttattctcgcagttgttgtcatcattattatcggtaatatgattggcggcggaggcggc
tcagaagccacttccaaaacatcaagcagcagcaaagcagaaactgaaaaaacatacaat
atcggtgataccgtaaaaactgaaaaaactgaagtgacggttacgaaggtagaggacaga
gatactgtcggtactcaatatgttgaaaagaaagcatctgagggaggtacaattgtagct
gttcaatatacaattaaaaacgtatctaaaaagccgattagctctttttcaattccaact
gttaaattagttgatgctgatggtacttcttatgattctgatattgatgcttctgtaaac
tatgcaactgagacaaaagttgataactctaaaattttgagtgatctaaatcctaatatt
aaagtaacaggtgtaaaagcatttgaagttgacaaggaagcttatgcaaaaggcacttgg
aaactaaaattcagtaatgatgttattgtgaaaatcaaataa

DBGET integrated database retrieval system