KEGG   Bacillus subtilis subsp. subtilis 168: BSU38870
Entry
BSU38870          CDS       T00010                                 

Symbol
yxkA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PBP
Other DBs
NCBI-GeneID: 937438
NCBI-ProteinID: NP_391766
Pasteur: BG11899
BSORF: BG11899
UniProt: P55185 A0A6M3ZHS8
Position
complement(3991082..3991588)
AA seq 168 aa
MNIYVEANPYLHDKYSKYADEKYKREGNPFVSFPIHFDDIPSGAKTLALTFIDHDAIPVC
GFSWIHWTAANIPAYIGELPEHASEERQDLMIQGQNSFASPLAGSNDPKVIHQYCGPTPP
DKDHAYTLTVYALDAELNLQPGFYLNELYQEMKEHILAETSIELLARV
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaacatatacgtagaagcaaatccatatttacatgacaagtattcaaaatacgcggat
gaaaaatataagagagaaggaaacccatttgtatcctttccaattcattttgatgacatc
ccgtccggagcaaagacgctcgcacttactttcatcgatcatgacgccattcccgtatgc
ggattcagctggattcactggacagcggctaatattccggcttacatcggagagcttcct
gaacatgcgagtgaggaaagacaggacttgatgatacaagggcaaaacagctttgcttca
ccgcttgcgggaagcaacgatccaaaggtgattcaccagtattgcgggccgacaccgcct
gacaaggatcatgcgtatacattgacggtctatgctttagatgctgagctgaatcttcag
ccgggcttttacttgaatgagctctatcaagaaatgaaagagcacattcttgctgaaacc
tctatcgaattgctggcaagggtttaa

DBGET integrated database retrieval system