KEGG   Bacillus subtilis subsp. subtilis 168: BSU38880
Entry
BSU38880          CDS       T00010                                 

Symbol
yxjO
Name
(RefSeq) HTH-type transcriptional regulator YxjO
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LysR_substrate HTH_1 HTH_5 HTH_24 HTH_20 MarR_2
Other DBs
NCBI-GeneID: 937423
NCBI-ProteinID: NP_391767
Pasteur: BG11898
BSORF: BG11898
UniProt: P55181 A0A6M3ZHR2
Position
3991718..3992593
AA seq 291 aa
MDLKWLQTFIAAAESESFREAAEHLYLTQPAVSQHMRKLEDELDMRLFLHSGRRVVLTDE
GRLFLPYAKEMIHVYQAGKQKVSQWKQGYSRSLTLAVHPYIASYILPRFLPAYIQKHPHV
ELSTHVAGSDAIKQAVEHNEADIGLSRKDPNTNTLYYQHICEGTLCLAAPFQESRPDAAS
VLTRYRLLTHDHPSYGDAFLDNIRSHYPYLQMMAVGQTDTAVHMMKAGMGASFLPTYIIK
QEEAEKKLMAVSTPAHLELPASQTFMMWKRNSEDIQHFHAMLHDFMQREQV
NT seq 876 nt   +upstreamnt  +downstreamnt
atggatttaaaatggctgcaaacctttattgccgcagcggaatcagagagcttcagggag
gcggctgagcatctgtatctcacacagcctgccgtttctcagcatatgaggaaattggaa
gatgaactggacatgaggttgtttttgcatagcggaagacgagtcgtactgactgacgaa
ggcaggctctttttgccttatgccaaagaaatgatccatgtttaccaagctggaaagcag
aaagtcagtcaatggaaacaggggtacagccgatcactcacgctggccgtacacccctac
attgcgtcctatatcttgcctcgctttctgccagcctatatccaaaaacatccgcatgtc
gagctttcaactcatgtggctggatctgacgctattaaacaagcggtggaacacaatgaa
gctgatattggtttgtcgcggaaagacccgaacaccaacactctttattatcagcatata
tgcgaaggtacgctttgtctggcggctcctttccaagaaagcagaccggatgctgcatcc
gtcttaacccgctatcggctgctaacgcatgatcatccgtcatatggggatgccttttta
gataacatccgatcacattacccgtatcttcaaatgatggctgtcgggcagacggatacg
gctgtccacatgatgaaagcgggaatgggggcatctttcctccctacctacattatcaaa
caggaagaagccgaaaaaaagctgatggctgtcagcacgcctgcacatctagaattgcct
gcgtcccaaacgtttatgatgtggaaaagaaacagcgaagacattcagcattttcacgcc
atgttacatgactttatgcagcgcgaacaagtatag

DBGET integrated database retrieval system