KEGG   Bacillus subtilis subsp. subtilis 168: BSU38890
Entry
BSU38890          CDS       T00010                                 

Symbol
yxjN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1453 MadL
Other DBs
NCBI-GeneID: 937424
NCBI-ProteinID: NP_391768
Pasteur: BG11897
BSORF: BG11897
UniProt: P55182 A0A6M4JQM0
Position
3992671..3993144
AA seq 157 aa
MAMSPYIFIVLILIILSMYRERTVKPGKLLIIPLLLLWGVSASFQPAYFHSVLHVAISGI
LLLIGLACGFGIGKMVNVRIHPETGKVTSRGSLGSVILILVILSLRMAARTWLPESNEMF
IAIIHSMFFVPLGTITARNIMLYKAYRRLTAGKVSIQ
NT seq 474 nt   +upstreamnt  +downstreamnt
atggcgatgagcccttatatttttattgtattgattcttattattttatcgatgtatcga
gaaagaacggtaaagcccgggaagttgctgatcattccactgttgctcttatggggcgta
tctgcatcgtttcagccggcgtattttcattccgtattacatgtggcgatcagcggcatt
ttattactgatcgggctggcctgcgggtttggcattgggaagatggtaaatgtacggatt
cacccggaaaccggaaaggtcacttcacgcggctcacttgggagtgttatcctcattcta
gtgatactttctttgcgcatggccgcgagaacatggctgcctgagagcaacgagatgttt
attgccattattcattctatgttcttcgttcccctcggcaccatcacagcccgcaacatc
atgctttacaaagcatacagacgactgaccgctggcaaagtatccattcaataa

DBGET integrated database retrieval system